1. Recombinant Proteins
  2. Others
  3. SPOP Protein, Human

SPOP Protein, Human is the recombinant human-derived SPOP, expressed by E. coli , with tag Free labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPOP Protein, Human is the recombinant human-derived SPOP, expressed by E. coli , with tag Free labeled tag. ,

Background

SPOP is a component of the cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates target protein ubiquitination, often leading to proteasomal degradation. In complex with CUL3, it ubiquitinates and degrades BRMS1, DAXX, PDX1/IPF1, GLI2, and GLI3, while ubiquitinating MACROH2A1 and BMI1 without degradation. It suppresses PDX1/IPF1 target gene (e.g., insulin) activation by promoting PDX1/IPF1 degradation. The homodimeric SPOP-containing BCR complex exhibits higher ubiquitin ligase activity than the SPOP/SPOPL heterodimer-containing complex. It regulates BET proteins (BRD2/3/4) stability, controls translation (not degradation) of DNA replication factors CDT1 and CDC6 for DNA synthesis, targets IRF1 via S/T-rich degrons, restricts EV71 replication by lysosomal degradation of viral protease 2A, and inhibits HBV via HNF1A ubiquitination. Additionally (by similar), it ubiquitinates BRDT to regulate histone removal during spermatogenesis.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O43791 (K28-V168)

Gene ID

8405

Protein Length

Partial

Synonyms
Speckle-type POZ protein; HIB homolog 1; Roadkill homolog 1; SPOP; Homo sapiens; Human
AA Sequence

KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSV

Predicted Molecular Mass
16.4 kDa
Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200mM NaCl, 20% glycerol, 1mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SPOP Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SPOP Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPOP Protein, Human
Cat. No.:
HY-P703241
Quantity:
MCE Japan Authorized Agent: