SPOP Protein, Human
Based on 1 Customer Validation
SPOP Protein, Human is the recombinant human-derived SPOP, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SPOP Protein, Human is the recombinant human-derived SPOP, expressed by E. coli , with tag Free labeled tag. ,
Background
SPOP is a component of the cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates target protein ubiquitination, often leading to proteasomal degradation. In complex with CUL3, it ubiquitinates and degrades BRMS1, DAXX, PDX1/IPF1, GLI2, and GLI3, while ubiquitinating MACROH2A1 and BMI1 without degradation. It suppresses PDX1/IPF1 target gene (e.g., insulin) activation by promoting PDX1/IPF1 degradation. The homodimeric SPOP-containing BCR complex exhibits higher ubiquitin ligase activity than the SPOP/SPOPL heterodimer-containing complex. It regulates BET proteins (BRD2/3/4) stability, controls translation (not degradation) of DNA replication factors CDT1 and CDC6 for DNA synthesis, targets IRF1 via S/T-rich degrons, restricts EV71 replication by lysosomal degradation of viral protease 2A, and inhibits HBV via HNF1A ubiquitination. Additionally (by similar), it ubiquitinates BRDT to regulate histone removal during spermatogenesis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O43791 (K28-V168)
-
Gene ID8405
-
Protein Length
Partial
-
Synonyms
SPOP; HIB Homolog 1; Speckle Type BTB/POZ Protein; NEDMACE; Speckle-Type POZ Protein; NEDMIDF; BTBD32; NSDVS1; TEF2; NSDVS2; Roadkill Homolog 1
-
AA Sequence
KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSV
-
Predicted Molecular Mass
16.4 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200mM NaCl, 20% glycerol, 1mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
