SRPX2 Protein, Human (HEK293, His)

The SRPX2 protein is a ligand for the urokinase plasminogen activator surface receptor and promotes angiogenesis by inducing endothelial cell migration and vascular network formation. It also exerts critical effects on cell migration and adhesion, increases FAK phosphorylation and enhances HGF mitogenic activity. SRPX2 Protein, Human (HEK293, His) is the recombinant mouse-derived SRPX2 protein, expressed by HEK293, with C-10*His labeled tag.

SRPX2 Protein serves as a ligand for the urokinase plasminogen activator surface receptor, contributing to angiogenesis by inducing endothelial cell migration and the formation of vascular networks. Additionally, it plays a crucial role in cellular migration and adhesion, elevates phosphorylation levels of FAK (focal adhesion kinase), and interacts with and enhances the mitogenic activity of HGF (hepatocyte growth factor). SRPX2 also participates in synapse formation and is essential for ultrasonic vocalizations. It forms homooligomers and interacts with PLAUR, ADAMTS4, and CTSB, further emphasizing its multifaceted roles in cellular processes and signaling pathways.

Human

HEK293

C-10*His

O60687 (T24-E465)

27286

Full Length of Mature Protein

TWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.