ssPA Protein, E. coli (His)
Based on 1 Customer Validation
The ssPA protein specifically forms an equimolar complex with RNA polymerase holoenzyme (RNAP), thereby distinguishing its interaction preference from the core enzyme. ssPA is primarily synthesized during amino acid starvation and accounts for more than 50% of the total protein produced under these conditions. ssPA Protein, E. coli (His) is the recombinant E. coli-derived ssPA protein, expressed by E. coli , with N-His labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The ssPA protein specifically forms an equimolar complex with RNA polymerase holoenzyme (RNAP), thereby distinguishing its interaction preference from the core enzyme. ssPA is primarily synthesized during amino acid starvation and accounts for more than 50% of the total protein produced under these conditions. ssPA Protein, E. coli (His) is the recombinant E. coli-derived ssPA protein, expressed by E. coli , with N-His labeled tag.
The ssPA (stringent starvation protein A) forms an equimolar complex with the RNA polymerase holoenzyme (RNAP) but does not associate with the core enzyme. Synthesized predominantly during amino acid starvation, ssPA constitutes over 50% of the total protein synthesized under such conditions. Its role is crucial in orchestrating the transition from P1 early to P1 late gene expression, suggesting its involvement in regulating gene expression during specific cellular states. Remarkably, the functional interchangeability observed between Rnk and SspA with the Pseudomonas aeruginosa alginate regulatory gene algR2 underscores the regulatory versatility of ssPA-like proteins in bacterial systems.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-His
-
Accession
P0ACA3 (M1-S212)
-
Gene ID61751941
-
Molecular Construction
-
N-term
-
His
-
ssPA (M1-S212)
Accession # P0ACA3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Stringent starvation protein A; sspA; pog; ssp; b3229; JW3198
-
AA Sequence
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYTLMNTIINGSASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPQLGIEFSGPGAKELKGYMTRVFERDSFLASLTEAEREMRLGRS
-
Predicted Molecular Mass
24.3 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
