SSTR2 Protein, Human (Cell-Free, His)
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Background
The SSTR2 Protein serves as a receptor for somatostatin-14 and -28, coupling with pertussis toxin-sensitive G proteins to inhibit adenylyl cyclase. Additionally, it stimulates phosphotyrosine phosphatase and PLC through pertussis toxin-insensitive and sensitive G proteins, while inhibiting calcium entry by suppressing voltage-dependent calcium channels. In pancreatic alpha- and beta-cells, SSTR2 acts as the functionally dominant somatostatin receptor, mediating the inhibitory effects of somatostatin-14 on hormone secretion. Beyond its role in pancreatic cells, SSTR2 inhibits cell growth by enhancing MAPK1 and MAPK2 phosphorylation, leading to the up-regulation of CDKN1B. It further contributes to neuronal migration and axon outgrowth, potentially participating in neuron development and maturation during brain development. SSTR2 mediates the negative regulation of insulin receptor signaling through PTPN6 and inactivates SSTR3 receptor function following heterodimerization. Existing as both homodimers and heterodimers with SSTR3 and SSTR5, SSTR2 undergoes agonist-induced dissociation into monomers, a crucial step for receptor internalization. Interactions with beta-arrestin and SHANK1 further modulate receptor internalization and function.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P30874 (M1-I369)
-
Gene ID6752
-
Molecular Construction
-
N-term
-
10*His
-
SSTR2 (M1-I369)
Accession # P30874 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SSTR2; SST2; Somatostatin Receptor 2; SS2R; Somatostatin Receptor Type 2; SS-2-R; SRIF-1; SS2-R
-
AA Sequence
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
-
Predicted Molecular Mass
47.4 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
