STAT5B Protein, Human (His)
Based on 1 Customer Validation
The STAT5B protein plays dual roles in signal transduction and transcriptional activation in response to KITLG/SCF and growth factors. STAT5B Protein, Human (His) is the recombinant human-derived STAT5B protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The STAT5B protein plays dual roles in signal transduction and transcriptional activation in response to KITLG/SCF and growth factors. STAT5B Protein, Human (His) is the recombinant human-derived STAT5B protein, expressed by E. coli , with C-6*His labeled tag.
STAT5B, a multifunctional protein, orchestrates signal transduction and transcriptional activation, playing a pivotal role in cellular responses to various stimuli, including the cytokine KITLG/SCF and other growth factors. Functioning as a transcription factor, STAT5B binds to the GAS element and facilitates PRL-induced transcription, positively regulating hematopoietic/erythroid differentiation. Upon activation, it forms homodimers and heterodimers with related family members, contributing to its diverse functional roles. Additionally, STAT5B engages in protein-protein interactions, including binding to NR3C1 and forming complexes with NCOA1, NMI, and SOCS7. Notably, its interaction with INSR, facilitated by the SH2 domain, highlights its involvement in insulin signaling. Moreover, the interaction with CPEB3 serves to inhibit STAT5B-mediated transcriptional activation, adding a layer of regulatory complexity to its diverse cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P51692 (M1-T321)
-
Molecular Construction
-
N-term
-
STAT5B (M1-T321)
Accession # P51692 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
STAT5B; Transcription Factor STAT5B; Signal Transducer And Activator Of Transcription 5B; GHISID2; Signal Transducer And Activator Of Transcription; STAT5
-
AA Sequence
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATIT
-
Predicted Molecular Mass
38.4 kDa
-
Molecular Weight
Approximately 36 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 10% trehalose, 1 mM DTT, 0.05% Tween 80, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
