SUMF1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The SUMF1 protein plays an important role as an oxidase that converts cysteine to 3-oxoalanine on specific target proteins such as GALNS, ARSA, STS, and ARSE. This enzymatic activity is essential for the maturation of arylsulfatase and alkaline phosphatase, leading to the formation of 3-oxoalanine (fGly). SUMF1 Protein, Human (HEK293, His) is the recombinant human-derived SUMF1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SUMF1 protein plays an important role as an oxidase that converts cysteine to 3-oxoalanine on specific target proteins such as GALNS, ARSA, STS, and ARSE. This enzymatic activity is essential for the maturation of arylsulfatase and alkaline phosphatase, leading to the formation of 3-oxoalanine (fGly). SUMF1 Protein, Human (HEK293, His) is the recombinant human-derived SUMF1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
SUMF1 Protein functions as an oxidase, facilitating the conversion of cysteine to 3-oxoalanine on specific target proteins, a process involving molecular oxygen and an unidentified reducing agent. This enzymatic activity is crucial for the maturation of arylsulfatases and some alkaline phosphatases, leading to the formation of 3-oxoalanine, also known as formylglycine (fGly). Notable substrates for SUMF1 include GALNS, ARSA, STS, and ARSE, highlighting its role in the modification of key proteins involved in various biological processes.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8NBK3-1 (S34-D374)
-
Molecular Construction
-
N-term
-
SUMF1 (S34-D374)
Accession # Q8NBK3-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SUMF1; UNQ3037; Sulfatase Modifying Factor 1; Sulfatase-Modifying Factor 1; FGE; FGly-Generating Enzyme; C-Alpha-Formylglycine-Generating Enzyme 1; AAPA3037; Formylglycine-Generating Enzyme
-
AA Sequence
SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD
-
Predicted Molecular Mass
38.4 kDa
-
Molecular Weight
Approximately 38-48 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 2 mM CaCl2, 10% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
