SYK Protein, Human (Active, sf9)

Customer Review

Based on 1 Customer Validation

SYK protein is a non-receptor tyrosine kinase that mediates signal transduction across different receptors, including B-cell receptors (BCR), affecting innate and adaptive immunity, cell adhesion, and osteoclast maturation , platelet activation and vascular development. SYK forms complexes with activated receptors, phosphorylates downstream effectors, and is critical in BCR and T cell receptor signaling. SYK Protein, Human (sf9) is the recombinant human-derived SYK protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SYK protein is a non-receptor tyrosine kinase that mediates signal transduction across different receptors, including B-cell receptors (BCR), affecting innate and adaptive immunity, cell adhesion, and osteoclast maturation , platelet activation and vascular development. SYK forms complexes with activated receptors, phosphorylates downstream effectors, and is critical in BCR and T cell receptor signaling. SYK Protein, Human (sf9) is the recombinant human-derived SYK protein, expressed by sf9 insect cells , with tag free.

Background

SYK Protein, a non-receptor tyrosine kinase, serves as a critical mediator of signal transduction downstream of various transmembrane receptors, including classical immunoreceptors like the B-cell receptor (BCR). Its regulatory influence spans multiple biological processes, encompassing innate and adaptive immunity, cell adhesion, osteoclast maturation, platelet activation, and vascular development. SYK assembles into signaling complexes with activated receptors at the plasma membrane, facilitated by the interaction between its SH2 domains and the receptor tyrosine-phosphorylated ITAM domains. This association can also occur indirectly through adapter proteins containing ITAM or partial hemITAM domains. Typically, SRC subfamily kinases mediate the phosphorylation of ITAM domains upon receptor engagement, although ITAM-independent signal transduction by SYK is observed more rarely. SYK directly phosphorylates downstream effectors, including DEPTOR, VAV1, PLCG1, PI-3-kinase, LCP2, and BLNK. Initially identified for its essential role in BCR signaling, SYK is indispensable for B-cell maturation, particularly at the pro-B to pre-B transition. Upon BCR engagement, it phosphorylates and activates BLNK, PLCG1, and the PKC signaling pathway, regulating B-cell antigen receptor (BCR)-coupled signaling. Beyond its role in BCR signaling, SYK plays a crucial role in T-cell receptor signaling and participates in the innate immune response against fungal, bacterial, and viral pathogens. Activated by the membrane lectin CLEC7A, SYK induces immune cell responses, including the production of reactive oxygen species (ROS), inflammasome activation, and NF-kappa-B-mediated transcription. SYK also regulates neutrophil degranulation and phagocytosis, mediates dendritic cell activation, and is involved in mast cell activation. Furthermore, SYK functions downstream of receptors mediating cell adhesion, influencing integrin-mediated activation of neutrophils and macrophages, P-selectin receptor/SELPG-mediated leukocyte recruitment to inflammatory sites, and non-immune processes such as vascular development and osteoclast function. It plays a pivotal role in platelet activation, being activated by collagen, fibrinogen-engaged ITGB3, and the membrane lectin CLEC1B, ultimately contributing to platelet adhesion and cytokine production. Together with CEACAM20, SYK enhances the production of the cytokine CXCL8/IL-8 via the NFKB pathway, suggesting a potential role in the intestinal immune response.

Verified Bioactivity

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.781 nM, the conversion rate is about 25%.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SYK (E356-N635)
      Accession # P43405-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SYK; Tyrosine-Protein Kinase SYK; Spleen Associated Tyrosine Kinase; P72-Syk; Spleen Tyrosine Kinase; IMD82

  • AA Sequence

    EEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00