SYK Protein, Human (Active, sf9)

SYK protein is a non-receptor tyrosine kinase that mediates signal transduction across different receptors, including B-cell receptors (BCR), affecting innate and adaptive immunity, cell adhesion, and osteoclast maturation , platelet activation and vascular development. SYK forms complexes with activated receptors, phosphorylates downstream effectors, and is critical in BCR and T cell receptor signaling. SYK Protein, Human (sf9) is the recombinant human-derived SYK protein, expressed by sf9 insect cells , with tag free.

SYK Protein, a non-receptor tyrosine kinase, serves as a critical mediator of signal transduction downstream of various transmembrane receptors, including classical immunoreceptors like the B-cell receptor (BCR). Its regulatory influence spans multiple biological processes, encompassing innate and adaptive immunity, cell adhesion, osteoclast maturation, platelet activation, and vascular development. SYK assembles into signaling complexes with activated receptors at the plasma membrane, facilitated by the interaction between its SH2 domains and the receptor tyrosine-phosphorylated ITAM domains. This association can also occur indirectly through adapter proteins containing ITAM or partial hemITAM domains. Typically, SRC subfamily kinases mediate the phosphorylation of ITAM domains upon receptor engagement, although ITAM-independent signal transduction by SYK is observed more rarely. SYK directly phosphorylates downstream effectors, including DEPTOR, VAV1, PLCG1, PI-3-kinase, LCP2, and BLNK. Initially identified for its essential role in BCR signaling, SYK is indispensable for B-cell maturation, particularly at the pro-B to pre-B transition. Upon BCR engagement, it phosphorylates and activates BLNK, PLCG1, and the PKC signaling pathway, regulating B-cell antigen receptor (BCR)-coupled signaling. Beyond its role in BCR signaling, SYK plays a crucial role in T-cell receptor signaling and participates in the innate immune response against fungal, bacterial, and viral pathogens. Activated by the membrane lectin CLEC7A, SYK induces immune cell responses, including the production of reactive oxygen species (ROS), inflammasome activation, and NF-kappa-B-mediated transcription. SYK also regulates neutrophil degranulation and phagocytosis, mediates dendritic cell activation, and is involved in mast cell activation. Furthermore, SYK functions downstream of receptors mediating cell adhesion, influencing integrin-mediated activation of neutrophils and macrophages, P-selectin receptor/SELPG-mediated leukocyte recruitment to inflammatory sites, and non-immune processes such as vascular development and osteoclast function. It plays a pivotal role in platelet activation, being activated by collagen, fibrinogen-engaged ITGB3, and the membrane lectin CLEC1B, ultimately contributing to platelet adhesion and cytokine production. Together with CEACAM20, SYK enhances the production of the cytokine CXCL8/IL-8 via the NFKB pathway, suggesting a potential role in the intestinal immune response.

Human

Sf9 insect cells

Tag Free

P43405-1 (E356-N635)

6850

Partial

EEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.