1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β
  5. TGF-β2
  6. TGF beta 2/TGFB2 Protein, Human (HEK293, Avi)

In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. TGF beta 2/TGFB2 Protein, Human (HEK293, Avi) is the recombinant human-derived TGF beta 2/TGFB2 protein, expressed by HEK293 , with C-Avi labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE TGF beta 2/TGFB2 Protein, Human (HEK293, Avi)

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. TGF beta 2/TGFB2 Protein, Human (HEK293, Avi) is the recombinant human-derived TGF beta 2/TGFB2 protein, expressed by HEK293 , with C-Avi labeled tag.

Background

As a central player in the TGF-beta-2 signaling pathway, the TGF beta 2/TGFB2 protein assumes the role of a precursor for both the Latency-associated peptide (LAP) and the Transforming growth factor beta-2 (TGF-beta-2) chains. These chains collectively form the regulatory and active subunits of TGF-beta-2, respectively. Notably, TGF beta 2/TGFB2 is essential for maintaining the TGF-beta-2 chain in a latent state during storage within the extracellular matrix. The protein engages in non-covalent associations with TGF-beta-2, intricately regulating its activation through interactions with 'milieu molecules,' including LTBP1 and LRRC32/GARP. These interactions play a pivotal role in controlling the activation of TGF-beta-2, contributing to the finely tuned regulation of this critical signaling pathway.

Biological Activity

Immobilized Biotinylated Human Mature TGF beta 2, Avi Tag at 2 μg/mL (100 μl/well) on the streptavidin precoated plate (5 μg/mL). Dose response curve for Human TGF-beta RII, mFc Tag with the EC50 of 0.75 μg/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi

Accession

P61812-1 (A303-S414)

Gene ID
Molecular Construction
N-term
TGFB2 (A303-S414)
Accession # P61812-1
Avi
C-term
Protein Length

Full Length of Mature TGFB2

Synonyms
TGFB2; TGFBR2; TGFR2; TbetaR-II; TGFβR2; BB105277; TGF-beta 2; TβR-II; TGF-β 2
AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Predicted Molecular Mass
14.5 kDa
분자량

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TGF beta 2/TGFB2 Protein, Human (HEK293, Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TGF beta 2/TGFB2 Protein, Human (HEK293, Avi)
Cat. No.:
HY-P700785
수량:
MCE Japan Authorized Agent: