Copy Link Print Information

TGF beta 2/TGFB2 Protein, Human (HEK293, Avi)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. TGF beta 2/TGFB2 Protein, Human (HEK293, Avi) is the recombinant human-derived TGF beta 2/TGFB2 protein, expressed by HEK293 , with C-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TGF beta 2/TGFB2 Protein, Human (HEK293, Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. TGF beta 2/TGFB2 Protein, Human (HEK293, Avi) is the recombinant human-derived TGF beta 2/TGFB2 protein, expressed by HEK293 , with C-Avi labeled tag.

Background

As a central player in the TGF-beta-2 signaling pathway, the TGF beta 2/TGFB2 protein assumes the role of a precursor for both the Latency-associated peptide (LAP) and the Transforming growth factor beta-2 (TGF-beta-2) chains. These chains collectively form the regulatory and active subunits of TGF-beta-2, respectively. Notably, TGF beta 2/TGFB2 is essential for maintaining the TGF-beta-2 chain in a latent state during storage within the extracellular matrix. The protein engages in non-covalent associations with TGF-beta-2, intricately regulating its activation through interactions with 'milieu molecules,' including LTBP1 and LRRC32/GARP. These interactions play a pivotal role in controlling the activation of TGF-beta-2, contributing to the finely tuned regulation of this critical signaling pathway.

Verified Bioactivity

Immobilized Biotinylated Human Mature TGF beta 2, Avi Tag at 2 μg/mL (100 μl/well) on the streptavidin precoated plate (5 μg/mL). Dose response curve for Human TGF-beta RII, mFc Tag with the EC50 of 0.75 μg/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi
  • Accession

    P61812-1 (A303-S414)

  • Gene ID
    7042  [NCBI]
  • Molecular Construction
    • N-term
    • TGFB2 (A303-S414)
      Accession # P61812-1
    • Avi
    • C-term
  • Protein Length

    Full Length of TGFB2 Chain

  • Synonyms

    TGFB2; Transforming Growth Factor, Beta 2; Transforming Growth Factor Beta 2; BSC-1 Cell Growth Inhibitor; Glioblastoma-Derived T-Cell Suppressor Factor; TGF-Beta2; Transforming Growth Factor Beta-2 Proprotein; Polyergin; Prepro-Transforming Growth Factor

  • AA Sequence

    ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

  • Predicted Molecular Mass

    14.5 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TGF beta 2/TGFB2 Protein, Human (HEK293, Avi) Product Image
    1/16
  • TGF beta 2/TGFB2 Protein, Human (HEK293, Avi) Product Image