TNFRSF13B Protein, Human

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human is the recombinant human-derived TNFRSF13B protein, expressed by E. coli , with tag free.

TNFRSF13B Protein serves as the receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS, demonstrating high-affinity binding to both ligands. Its activation results in calcineurin-dependent activation of NF-AT, along with the activation of NF-kappa-B and AP-1, thereby playing a crucial role in stimulating B- and T-cell function and regulating humoral immunity. Additionally, TNFRSF13B binds TRAF2, TRAF5, and TRAF6, suggesting its involvement in various signaling pathways. Notably, it interacts with the NH2-terminal domain of CAMLG using its C-terminus.

Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF13B at 2 μg/ml (100 μL/well) can bind biotinylated Human APRIL.The ED₅₀ for this effect is 25.22 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF13B at 2 μg/mL (100 μL/well) can bind biotinylated Human APRIL.The ED₅₀ for this effect is 25.22 ng/mL.

Human

E. coli

Tag Free

O14836-1 (M1-V160)

23495  [NCBI]

Extracellular Domain

MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.