Copy Link Print Information

TNKS1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The TNKS1 protein is a polyADP-ribosyltransferase that is integral to multiple cellular processes, including the Wnt signaling pathway, telomere length regulation, and vesicle trafficking. In Wnt signaling, TNKS1 activates this pathway by poly-ADP-ribosylating AXIN1 and AXIN2, promoting their degradation. TNKS1 Protein, Human (His) is the recombinant human-derived TNKS1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • TNKS1 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The TNKS1 protein is a polyADP-ribosyltransferase that is integral to multiple cellular processes, including the Wnt signaling pathway, telomere length regulation, and vesicle trafficking. In Wnt signaling, TNKS1 activates this pathway by poly-ADP-ribosylating AXIN1 and AXIN2, promoting their degradation. TNKS1 Protein, Human (His) is the recombinant human-derived TNKS1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

TNKS1, a poly-ADP-ribosyltransferase, plays a pivotal role in diverse cellular processes, including the Wnt signaling pathway, telomere length regulation, and vesicle trafficking. In the Wnt signaling cascade, TNKS1 acts as an activator by mediating poly-ADP-ribosylation (PARsylation) of key components of the beta-catenin destruction complex, namely AXIN1 and AXIN2. This modification facilitates their recognition by RNF146, leading to ubiquitination and subsequent degradation. TNKS1 is also involved in the regulation of telomere length through PARsylation of TERF1. Furthermore, it participates in centrosome maturation during prometaphase by mediating PARsylation of HEPACAM2/MIKI and may influence vesicle trafficking by modulating the subcellular distribution of SLC2A4/GLUT4-vesicles. Additionally, TNKS1 is implicated in spindle pole assembly through PARsylation of NUMA1 and contributes to the stimulation of 26S proteasome activity, highlighting its multifaceted functions in cellular physiology.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    O95271 (Q1091-Q1325)

  • Gene ID
    8658
  • Molecular Construction
    • N-term
    • 6*His
    • TNKS1 (Q1091-Q1325)
      Accession # O95271
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNKS; ADP-Ribosyltransferase Diphtheria Toxin-Like 5; Tankyrase; Poly [ADP-Ribose] Polymerase Tankyrase-1; PARP5A; Poly [ADP-Ribose] Polymerase 5A; ARTD5; Tankyrase-1; TNKS1; Tankyrase I; TINF1; TNKS-1; TIN1; TANK1; PARP-5a; PARPL; PART5; TRF1-Interacting

  • AA Sequence

    QGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQ

  • Predicted Molecular Mass

    28.8 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TNKS1 Protein, Human (His) Product Image
    1/16
  • TNKS1 Protein, Human (His) Product Image