1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. TNKS1 Protein, Human (His)

The TNKS1 protein is a polyADP-ribosyltransferase that is integral to multiple cellular processes, including the Wnt signaling pathway, telomere length regulation, and vesicle trafficking. In Wnt signaling, TNKS1 activates this pathway by poly-ADP-ribosylating AXIN1 and AXIN2, promoting their degradation. TNKS1 Protein, Human (His) is the recombinant human-derived TNKS1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TNKS1 protein is a polyADP-ribosyltransferase that is integral to multiple cellular processes, including the Wnt signaling pathway, telomere length regulation, and vesicle trafficking. In Wnt signaling, TNKS1 activates this pathway by poly-ADP-ribosylating AXIN1 and AXIN2, promoting their degradation. TNKS1 Protein, Human (His) is the recombinant human-derived TNKS1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

TNKS1, a poly-ADP-ribosyltransferase, plays a pivotal role in diverse cellular processes, including the Wnt signaling pathway, telomere length regulation, and vesicle trafficking. In the Wnt signaling cascade, TNKS1 acts as an activator by mediating poly-ADP-ribosylation (PARsylation) of key components of the beta-catenin destruction complex, namely AXIN1 and AXIN2. This modification facilitates their recognition by RNF146, leading to ubiquitination and subsequent degradation. TNKS1 is also involved in the regulation of telomere length through PARsylation of TERF1. Furthermore, it participates in centrosome maturation during prometaphase by mediating PARsylation of HEPACAM2/MIKI and may influence vesicle trafficking by modulating the subcellular distribution of SLC2A4/GLUT4-vesicles. Additionally, TNKS1 is implicated in spindle pole assembly through PARsylation of NUMA1 and contributes to the stimulation of 26S proteasome activity, highlighting its multifaceted functions in cellular physiology.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O95271 (Q1091-Q1325)

Gene ID

8658

Molecular Construction
N-term
6*His
TNKS1 (Q1091-Q1325)
Accession # O95271
C-term
Protein Length

Partial

Synonyms
TNKS; Poly [ADP-ribose] polymerase tankyrase-1; ADP-ribosyltransferase diphtheria toxin-like 5; ARTD5; Poly [ADP-ribose] polymerase 5A; Protein poly-ADP-ribosyltransferase tankyrase-1; TNKS-1; TRF1-interacting ankyrin-related ADP-ribose polymerase; Tankyrase I; Tankyrase-1; TANK1
AA Sequence

QGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQ

Predicted Molecular Mass
28.8 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TNKS1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TNKS1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNKS1 Protein, Human (His)
Cat. No.:
HY-P701631
Quantity:
MCE Japan Authorized Agent: