TXLNA Protein, Human (His)
Based on 1 Customer Validation
The TXLNA protein may be involved in intracellular vesicle trafficking, specifically calcium-dependent exocytosis in neuroendocrine cells. Its binding kinetics involve interactions with the C-terminal coiled-coil region of synaptophysin family members such as STX1A, STX3A, and STX4A. TXLNA Protein, Human (His) is the recombinant human-derived TXLNA protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The TXLNA protein may be involved in intracellular vesicle trafficking, specifically calcium-dependent exocytosis in neuroendocrine cells. Its binding kinetics involve interactions with the C-terminal coiled-coil region of synaptophysin family members such as STX1A, STX3A, and STX4A. TXLNA Protein, Human (His) is the recombinant human-derived TXLNA protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
TXLNA Protein emerges as a potential participant in intracellular vesicle traffic and may play a role in calcium-dependent exocytosis in neuroendocrine cells. Its interaction dynamics are characterized by binding to the C-terminal coiled coil region of syntaxin family members, including STX1A, STX3A, and STX4A. Notably, this binding occurs when these syntaxins are not complexed with SNAP25, VAMP2, or STXBP1, implying that TXLNA interacts specifically with syntaxins that are not part of the SNARE complex. The specificity of its interactions suggests a nuanced role in intracellular vesicle trafficking, potentially influencing neuroendocrine cell functions. Elucidating the precise mechanisms through which TXLNA modulates vesicle traffic and its involvement in calcium-dependent exocytosis could provide valuable insights into its functional significance in cellular processes related to neurotransmission and secretion.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;C-6*His
-
Accession
P40222 (M1-K162)
-
Molecular Construction
-
N-term
-
6*His
-
TXLNA (M1-K162)
Accession # P40222 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TXLNA; TXLN; Alpha-taxilin; TXLNA Protein; Interleukin 14; IL14; IL-14; Taxilin Alpha; DKFZp451J011
-
AA Sequence
MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEK
-
Predicted Molecular Mass
20.4 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
