UBE2D2 Protein, Xenopus (His)
UBE2D2 Protein, Xenopus (His) is the recombinant Xenopus laevis-derived UBE2D2, expressed by E. coli , with His labeled tag. ,
- Species: Xenopus laevis
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Technical Parameters
-
Species Xenopus laevis
-
Source E. coli
-
Tag His
-
Accession
Q6DFK8 (M1-M147)
-
Gene ID446340
-
Protein Length
Full Length
-
Synonyms
ube2d1.L; ube2d1; ube2d1.S; ube2d2-prov; E2 ubiquitin-conjugating enzyme; EC 2.3.2.23
-
AA Sequence
MALKRIQKELNDLQRDPPAQCSAGPVGDDLFHWQATIMGPTDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRLAREWTQKYAM
-
Predicted Molecular Mass
17 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
