VMO1 Protein, Human (HEK293, His)
Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen鈥檚 eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293, His) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen鈥檚 eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293, His) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen’s eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. Determination of the crystal structure of VMO1 revealed that VMO1 may interact with glycosylated proteins.VMO1 is a secreted protein and exerts important functions in inner ear and tear film[1].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q7Z5L0-1 (Q25-S202)
-
Molecular Construction
-
N-term
-
VMO1 (Q25-S202)
Accession # Q7Z5L0-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
VMO1; Vitelline Membrane Outer Layer 1 Homolog; Vitelline Membrane Outer Layer Protein 1 Homolog; Vitelline Membrane Outer Layer 1 Homolog (Chicken); ERGA6350; PRO21055
-
AA Sequence
QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS
-
Predicted Molecular Mass
20.1 kDa
-
Molecular Weight
Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
