VSIG8 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

VSIG8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG8 protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

VSIG8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG8 protein, expressed by HEK293, with C-6*His labeled tag.

Background

V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines (IL-2, IFN-γ, IL-17, IL-6, and IL-19), chemokines (MCP-1, MCP-10, and IP-10) and other proteins (IGFBP3 and RBP4) on anti-CD3 activated human CD3 T cells. VSIG-8 significantly reduces the production of IFN-γand IL-2 on both CD4 and CD8 T cells in the presence of T-cell receptor signaling. VSIG-8 markedly suppresses anti-CD3-induced human T cell proliferation and profoundly decreases the conversion of naïve CD4+ T cells into Th1 cells[1][2].

Verified Bioactivity

Measured by its ability to chemoattract Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.7887 μg/ml, corresponding to a specific activity is 1267.91 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • VSIG8 (V22-G262)
      Accession # Q6P3A4-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    VSIG8; V-Set And Immunoglobulin Domain Containing 8; V-Set And Immunoglobulin Domain-Containing Protein 8; C1orf204

  • AA Sequence

    VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVG

  • Predicted Molecular Mass

    26.7 kDa

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00