WBP2 Protein, Human (His)

WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

NLRP1 protein acts as the sensor component of the NLRP1 inflammasome, a crucial mediator of inflammasome activation in response to various pathogen-associated signals, leading to subsequent pyroptosis. As a recognition receptor, NLRP1 identifies specific pathogens and damage-associated signals, initiating the formation of the inflammasome polymeric complex composed of NLRP1, CASP1, and PYCARD/ASC. Upon pathogen-associated signals, the N-terminal part of NLRP1 is degraded, releasing the cleaved C-terminal part, which polymerizes and associates with PYCARD/ASC. This complex recruits pro-caspase-1, promoting caspase-1 activation and subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), leading to pyroptosis. In the absence of GSDMD, the NLRP1 inflammasome recruits and activates CASP8, leading to gasdermin-E (GSDME) activation. NLRP1 activation is also required for HMGB1 secretion, stimulating inflammatory responses. Recognizing pathogen-associated signals like human rhinoviruses, positive-strand RNA viruses, and muramyl dipeptide, NLRP1 plays a pivotal role in antiviral immunity and inflammation. Additionally, UV-B irradiation induces ribosome collisions, activating NLRP1 through MAP3K20-dependent phosphorylation and leading to pyroptosis. NLRP1 constitutes the precursor of the NLRP1 inflammasome, undergoing autoproteolytic processing within the FIIND domain in response to pathogens and damage-associated signals.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • WBP2 (M1-A100)
      Accession # Q969T9-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    WBP2; WW Domain Binding Protein 2; WBP-2; GRAMD6; WW Domain-Binding Protein 2; CDNA FLJ59459, Highly Similar To WW Domain-Binding Protein 2; Alternative Protein WBP2; DFNB107

  • AA Sequence

    MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA

  • Predicted Molecular Mass

    13.4 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00