WBP2 Protein, Human (His)
WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
NLRP1 protein acts as the sensor component of the NLRP1 inflammasome, a crucial mediator of inflammasome activation in response to various pathogen-associated signals, leading to subsequent pyroptosis. As a recognition receptor, NLRP1 identifies specific pathogens and damage-associated signals, initiating the formation of the inflammasome polymeric complex composed of NLRP1, CASP1, and PYCARD/ASC. Upon pathogen-associated signals, the N-terminal part of NLRP1 is degraded, releasing the cleaved C-terminal part, which polymerizes and associates with PYCARD/ASC. This complex recruits pro-caspase-1, promoting caspase-1 activation and subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), leading to pyroptosis. In the absence of GSDMD, the NLRP1 inflammasome recruits and activates CASP8, leading to gasdermin-E (GSDME) activation. NLRP1 activation is also required for HMGB1 secretion, stimulating inflammatory responses. Recognizing pathogen-associated signals like human rhinoviruses, positive-strand RNA viruses, and muramyl dipeptide, NLRP1 plays a pivotal role in antiviral immunity and inflammation. Additionally, UV-B irradiation induces ribosome collisions, activating NLRP1 through MAP3K20-dependent phosphorylation and leading to pyroptosis. NLRP1 constitutes the precursor of the NLRP1 inflammasome, undergoing autoproteolytic processing within the FIIND domain in response to pathogens and damage-associated signals.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q969T9-1 (M1-A100)
-
Molecular Construction
-
N-term
-
6*His
-
WBP2 (M1-A100)
Accession # Q969T9-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
WBP2; WW Domain Binding Protein 2; WBP-2; GRAMD6; WW Domain-Binding Protein 2; CDNA FLJ59459, Highly Similar To WW Domain-Binding Protein 2; Alternative Protein WBP2; DFNB107
-
AA Sequence
MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA
-
Predicted Molecular Mass
13.4 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)