ZBTB17 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The ZBTB17 protein is a multifunctional transcription factor that functions as a binding partner-based activator or repressor and a targeted regulator of cell cycle progression. It is essential for early lymphocyte development, preventing apoptosis and ensuring lineage commitment. ZBTB17 Protein, Human (His) is the recombinant human-derived ZBTB17 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ZBTB17 protein is a multifunctional transcription factor that functions as a binding partner-based activator or repressor and a targeted regulator of cell cycle progression. It is essential for early lymphocyte development, preventing apoptosis and ensuring lineage commitment. ZBTB17 Protein, Human (His) is the recombinant human-derived ZBTB17 protein, expressed by E. coli , with N-6*His labeled tag.

Background

ZBTB17, a versatile transcription factor, functions as either an activator or repressor depending on its binding partners and its target negative regulators of cell cycle progression. It plays a crucial role in early lymphocyte development, preventing apoptosis in lymphoid precursors, enabling survival in response to IL7, and ensuring proper lineage commitment. ZBTB17 has been identified binding to the promoters of adenovirus major late protein and cyclin D1, activating transcription. Essential for early embryonic development during gastrulation, ZBTB17 also represses RB1 transcription, an effect counteracted by its interaction with ZBTB49 isoform 3/ZNF509S1. Through homooligomerization, required for DNA binding, ZBTB17 interacts with GIF1, leading to MYB recruitment to the CDKN1A/p21 and CDKN1B promoters, repressing transcription. Furthermore, it interacts with TRAF2, inhibiting TRAF2 E3 ligase activity, and associates with MYC, rendering ZBTB17 insoluble in the nucleus and inhibiting its transactivation and growth arrest activities. Additional interactions with HCFC1, MAGEA4, TMPRSS11A, and BCL6 further illustrate the intricate regulatory network orchestrated by ZBTB17 in cellular processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • ZBTB17 (M1-A188)
      Accession # Q13105
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ZBTB17; Zinc Finger And BTB Domain Containing 17; ZNF151; ZNF60; Zinc Finger Protein 60; PHZ-67; MIZ1; Zinc Finger And BTB Domain-Containing Protein 17; Zinc Finger Protein 151 (PHZ-67); Myc-Interacting Zinc Finger Protein 1; Myc-Interacting Zn Finger Pro

  • AA Sequence

    MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADA

  • Predicted Molecular Mass

    22.3 kDa

  • Molecular Weight

    Approximately 18-26 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00