1802086-21-0
Chemical Structure
Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42)
- CAS No.: 1802086-21-0
- Formula:C220H343N63O64S2
- Molecular Weight:4958.59
SMILES: [CGKRDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA]
Biological Activity: Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) can be used in research of Alzheimer's disease[1].
| Cat. No. | Product Name | Purity | Description | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) | Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) can be used in research of Alzheimer's disease. | |||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||