BD-4 Protein, Human
Based on 1 Customer Validation
BD-4 Protein, Human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
BD-4 Protein, Human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity.
Human Beta Defensin-4 (hBD-4) expression is up-regulated by infection with gram-positive and gram-negative bacteria in human respiratory epithelial cells, and in response to phorbol 12-myristate 13-acetate, but not in response to other inflammatory factors that up-regulate the expression of hBD-2 or hBD-3. Synthetic hBD-4 exhibits a selective, salt-sensitive spectrum of antimicrobial activity, and it represents one of the most active antimicrobial peptides against Pseudomonas aeruginosa (minimal inhibitory concentration: 4.1 μg/mL) known to date[1].
Full biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 0.1-100 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8WTQ1 (E23-P72)
-
Gene ID140596 [NCBI]
-
Molecular Construction
-
N-term
-
BD-4 (E23-P72)
Accession # Q8WTQ1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Beta-defensin 4; BD-4; BD-2; Defensin; beta 4; RBD-2; RBD-4; Defb4; Defb2; Defb3
-
AA Sequence
EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)