Copy Link Print Information

Collagen Alpha-1(XVIII) Chain/Endostatin Protein, Human (P.pastoris)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Endostatin Protein, Human (P.pastoris) is an endogenous antiangiogenic peptide with multiple antitumor roles through modulation of various receptors in the plasma membrane, such as suppression of angiogenesis and inhibition of tumor-cell migration and invasion.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Collagen Alpha-1(XVIII) Chain/Endostatin Protein, Human (P.pastoris)
  • Collagen Alpha-1(XVIII) Chain/Endostatin Protein, Human (P.pastoris) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Endostatin Protein, Human (P.pastoris) is an endogenous antiangiogenic peptide with multiple antitumor roles through modulation of various receptors in the plasma membrane, such as suppression of angiogenesis and inhibition of tumor-cell migration and invasion.

Background

Recombinant Human Endostatin is an endogenous antiangiogenic peptide with multiple antitumor roles through modulation of various receptors in the plasma membrane, such as suppression of angiogenesis and inhibition of tumor-cell migration and invasion[1]. Recombinant Human Endostatin (rhEndostatin) shows a potent bioactivity and is capable of synergizing with CTX and DDP in suppression of tumor cell growth[2].

Verified Bioactivity

The ED50 is 10 μg/mL as measured by Endothelial cells.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag Tag Free
  • Accession

    P39060-3 (A1571-K1754)

  • Gene ID
    80781  [NCBI]
  • Molecular Construction
    • N-term
    • COL18A1 (A1571-K1754)
      Accession # P39060-3
    • C-term
  • Protein Length

    Full Length of Endostatin Chain

  • Synonyms

    COL18A1; Collagen Alpha-1(XVIII) Chain Isoform 1 Preproprotein; Prev. KNO; Collagen, Type XVIII, Alpha 1, Isoform CRA_b; KNO1; Multi-Functional Protein MFP; KS; Alternative Protein COL18A1; Collagen, Type XVIII, Alpha 1; Knobloch Syndrome, Type 1; Collage

  • AA Sequence

    AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK

  • Predicted Molecular Mass

    20.2 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 17 mM citric-phosphate buffer, pH 6.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Guo ZY, et al. Effect of recombinant human endostatin on the expression of c-Myc and bFGF in mouse gastric cancer cells. Genet Mol Res. 2015 May 18;14(2):5258-65. [Content Brief]

[2]. Ren Z, et al. Anti-tumor effect of a novel soluble recombinant human endostatin: administered as a single agent or in combination with chemotherapy agents in mouse tumor models. PLoS One. 2014 Sep 17;9(9):e107823. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Collagen Alpha-1(XVIII) Chain/Endostatin Protein, Human (P.pastoris) Product Image
    1/16
  • Experimental Validation Results for Collagen Alpha-1(XVIII) Chain/Endostatin Protein, Human (P.pastoris)
  • Collagen Alpha-1(XVIII) Chain/Endostatin Protein, Human (P.pastoris) Product Image