TNFRSF11B/OPG Protein, Human (CHO, Fc)
Based on 1 publication(s) in Google Scholar
Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Human (CHO, Fc) is a recombinant human TNFRSF11B/OPG (E22-L201) with C-terminal hFc tag, which is produced in CHO cell.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis[1]. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Human (CHO, Fc) is a recombinant human TNFRSF11B/OPG (E22-L201) with C-terminal hFc tag, which is produced in CHO cell[1][2].
Osteoprotegerin (OPG), a glycoprotein, belongs to TNF receptor superfamily. OPG is expressed in many tissues besides osteoblasts, including heart, kidney, liver, spleen, and bone marrow. Human osteoprotegerin shares <85% aa sequence identity with mouse and rat. Mouse OX40 shares 94.5% aa sequence identity with rat[1].
Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis. Osteoprotegerin also protects large blood vessels from medial calcification. Increased osteoprotegerin levels have been consistently associated with the incidence and prevalence of coronary artery disease[1][3]. Osteoprotegerin is also involved in multiple processes of cancers, such as tumor survival, epithelial to mesenchymal transition (EMT), neo-angiogenesis, invasion, and metastasis[2].
Osteoprotegerin plays a critical role in bone remodeling, and has osteoprotective effect[1].
RANKL (human, 0-100 pg/mL, 36 h) promotes the proliferation of VSMC[5].
Osteoprotegerin (human, 5 mg/kg, i.v.) shows antiresorptive effects in rats[4].
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Int Immunopharmacol
Timosaponin AIII from Anemarrhena asphodeloides binds and inhibits S100A8-mediated neutrophil infiltration and NET formation ameliorates MASH. [Abstract]2025 Sep 20:166:115539. PMID: 40976053
Technical Parameters
-
Species Human
-
Source CHO
-
Tag C-hFc
-
Accession
O00300 (E22-L201)
-
Molecular Construction
-
N-term
-
TNFRSF11B (E22-L201)
Accession # O00300 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TNFRSF11B; Osteoprotegerin; Prev. OPG; Tumor Necrosis Factor Receptor Superfamily, Member 11b; OCIF; Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; PDB5; TNF Receptor Superfamily Member 11b; TR1
-
AA Sequence
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL
-
Predicted Molecular Mass
47.2 kDa
-
Molecular Weight
Approximately 50-80 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Boyce BF, et al. Biology of RANK, RANKL, and osteoprotegerin. Arthritis Res Ther. 2007;9 Suppl 1(Suppl 1):S1. [Content Brief]
[2]. Simonet WS, et al. Osteoprotegerin: a novel secreted protein involved in the regulation of bone density. Cell. 1997 Apr 18;89(2):309-19. [Content Brief]
[3]. Wang Y, et al. The roles of osteoprotegerin in cancer, far beyond a bone player. Cell Death Discov. 2022 May 6;8(1):252. [Content Brief]
[4]. Udagawa N, et al. Osteoprotegerin produced by osteoblasts is an important regulator in osteoclast development and function. Endocrinology. 2000 Sep;141(9):3478-84. [Content Brief]
[5]. Venuraju SM, et al. Osteoprotegerin as a predictor of coronary artery disease and cardiovascular mortality and morbidity. J Am Coll Cardiol. 2010 May 11;55(19):2049-61. [Content Brief]
[6]. Baud'huin M, et al. Osteoprotegerin: multiple partners for multiple functions. Cytokine Growth Factor Rev. 2013 Oct;24(5):401-9. [Content Brief]
[7]. Capparelli C, et al. Sustained antiresorptive effects after a single treatment with human recombinant osteoprotegerin (OPG): a pharmacodynamic and pharmacokinetic analysis in rats. J Bone Miner Res. 2003 May;18(5):852-8. [Content Brief]
[8]. Candido R, et al. Human full-length osteoprotegerin induces the proliferation of rodent vascular smooth muscle cells both in vitro and in vivo. J Vasc Res. 2010;47(3):252-61. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
