Dendroaspis Natriuretic Peptide
Based on 1 Customer Validation
Dendroaspis Natriuretic Peptide is a vasodilator peptide that can be isolated from animal venom.
For research use only. We do not sell to patients.
- Purity: 96.70%
- CAS No.: 255721-52-9
- Formula: C180H282N56O56S2
- Molecular Weight:4190.64
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Chemical Information
-
CAS No. 255721-52-9
-
Appearance Solid
-
Molecular Weight 4190.64
-
Formula C180H282N56O56S2
-
Color White to light yellow
-
Sequence
Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala (Disulfide bridge: Cys7-Cys23)
-
Sequence Shortening
EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA (Disulfide bridge: Cys7-Cys23)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 100 mg/mL (23.86 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (288 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2386 mL | 1.1931 mL | 2.3863 mL | 5.9657 mL |
| 5 mM | 0.0477 mL | 0.2386 mL | 0.4773 mL | 1.1931 mL | |
| 10 mM | 0.0239 mL | 0.1193 mL | 0.2386 mL | 0.5966 mL | |
| 15 mM | 0.0159 mL | 0.0795 mL | 0.1591 mL | 0.3977 mL | |
| 20 mM | 0.0119 mL | 0.0597 mL | 0.1193 mL | 0.2983 mL |
Dendroaspis Natriuretic Peptide Related Classifications
HY-P5059 Related Classifications
Powered by Bioz