Berobenatide
Based on 1 Customer Validation
Berobenatide (PF-08653944; MET-097) is a GLP-1R agonist that exerts functional regulation of GLP-1R biased toward the Gs protein signaling pathway. Berobenatide induces weight loss in diet-induced obese mice. Berobenatide can be used in obesity-related research.
Para uso exclusivo en investigación. No vendemos a pacientes.
- No. CAS: 3028974-74-2
- Fòrmula: C232H369N57O68
- Peso molecular:5044.75
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Descripciòn
IC50 & Target
[1]|
GLP-1 |
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Diet-Induced Obese (DIO)[1]
-
Dosage:0.24 nmol/kg; 0.8 nmol/kg
-
Administration:s.c.; daily; 22 days, with dose doubled on day 7 and day 14
-
Result:Produced a body weight change of approximately -28% by day 22 at 0.8 nmol/kg final dose.
Induced body weight loss equivalent to that of equimolar doses of Semaglutide and Tirzepatide at 0.24 nmol/kg final dose.
Chemical Information
-
No. CAS 3028974-74-2
-
Appearance Solid
-
Peso molecular 5044.75
-
Fòrmula C232H369N57O68
-
Synonyms
PF-08653944; MET-097
-
Sequence
Phe-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Leu-Glu-Glu-Lys-Arg-Val-Arg-Glu-Phe-Ile-Glu-Trp-Leu-Lys-Gln-Gly-Gly-Pro-Ser-Ser-Gly-Lys-Pro-Pro-Pro-Gly-Lys-{Lys(γGlu-C20 diacid)}
-
Sequence Shortening
F-{Aib}-EGTFTSDVSKQLEEKRVREFIEWLKQGGPSSGKPPPGK-{Lys(γGlu-C20 diacid)}
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Pureza y Documentación
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Berobenatide Related Classifications
HY-P11235 Related Classifications
Powered by Bioz