Prepro-Atrial Natriuretic Factor (26-55) (human)
Based on 1 Customer Validation
Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.
For research use only. We do not sell to patients.
- Purity : 98.99%
- CAS No.: 112160-82-4
- Formula: C152H236N38O51S3
- Molecular Weight:3507.92
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
Chemical Information
-
CAS No. 112160-82-4
-
Appearance Solid
-
Molecular Weight 3507.92
-
Formula C152H236N38O51S3
-
Color White to off-white
-
Sequence
Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp
-
Sequence Shortening
NPMYNAVSNADLMDFKNLLDHLEEKMPLED
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : ≥ 100 mg/mL (28.51 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (279 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2851 mL | 1.4253 mL | 2.8507 mL | 7.1267 mL |
| 5 mM | 0.0570 mL | 0.2851 mL | 0.5701 mL | 1.4253 mL | |
| 10 mM | 0.0285 mL | 0.1425 mL | 0.2851 mL | 0.7127 mL | |
| 15 mM | 0.0190 mL | 0.0950 mL | 0.1900 mL | 0.4751 mL | |
| 20 mM | 0.0143 mL | 0.0713 mL | 0.1425 mL | 0.3563 mL | |
| 25 mM | 0.0114 mL | 0.0570 mL | 0.1140 mL | 0.2851 mL |