2B4/CD244 Protein, Human (HEK293, His)
2B4/CD244 protein exhibits heightened affinity for binding to CD48, surpassing isoform 1, leading to increased cytotoxicity and intracellular calcium release. The stronger interaction implies more robust engagement, potentially amplifying cellular responses, particularly heightened cytotoxic activity and intracellular calcium release. 2B4/CD244 Protein, Human (HEK293, His) is the recombinant human-derived 2B4/CD244 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
2B4/CD244 protein exhibits heightened affinity for binding to CD48, surpassing isoform 1, leading to increased cytotoxicity and intracellular calcium release. The stronger interaction implies more robust engagement, potentially amplifying cellular responses, particularly heightened cytotoxic activity and intracellular calcium release. 2B4/CD244 Protein, Human (HEK293, His) is the recombinant human-derived 2B4/CD244 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The 2B4/CD244 protein demonstrates a higher affinity for binding to CD48 compared to isoform 1, and this interaction results in heightened cytotoxicity and intracellular calcium release. The stronger binding between 2B4/CD244 and CD48 suggests a more robust engagement, potentially leading to enhanced cellular responses, including increased cytotoxic activity and release of intracellular calcium.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9BZW8-2 (C22-R221)
-
Molecular Construction
-
N-term
-
CD244 (C22-R221)
Accession # Q9BZW8-2 -
6*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD244; Signaling Lymphocytic Activation Molecule 4; CD244 Molecule; NK Cell Type I Receptor Protein 2B4; NKR2B4; NK Cell Activation-Inducing Ligand; SLAMF4; SLAM Family Member 4; NAIL; H2B4; 2B4; NK Cell Activation Inducing Ligand NAIL; Natural Killer Cel
-
AA Sequence
CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR
-
Predicted Molecular Mass
23.1 kDa
-
Molecular Weight
Approximately 35-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
