AATK Protein, Mouse (sf9, GST)

AATK Protein, Mouse (sf9, GST) is the recombinant mouse-derived AATK, expressed by Sf9 insect cells, with GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

AATK Protein, Mouse (sf9, GST) is the recombinant mouse-derived AATK, expressed by Sf9 insect cells, with GST labeled tag.

Background

AATK may be involved in neuronal differentiation. by similar: Its function is potentially associated with neural development.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    AATK; Protein Phosphatase 1, Regulatory Subunit 77; Apoptosis Associated Tyrosine Kinase; Brain Apoptosis-Associated Tyrosine Kinase; AATYK; Serine/Threonine-Protein Kinase LMTK1; LMTK1; CDK5-Binding Protein; LMR1; P35-Binding Protein; Lemur Tyrosine Kina

  • AA Sequence

    PSFAFSSHFDPDGAPLSELSWSSSLAVVAVSFSGIFTVVILMLACLCCKKGGIGFKEFENAEGDEYVADFSEQGSPAAAAQTGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDLGRHSLLYLKEIGHGWFGKVFLGEVHSGVSGTQVVVKELKVSASVQEQMQFLEEAQPYRALQHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVTESMAPDPLTLQRMACEVACGVLHLHRHNYVHSDLALRNCLLTADLTVKVGDYGLSHCKYREDYLVTADQLWVPLRWIAPELVDEVHGNLLVVDQTKSSNVWSLGVTIWELFELGAQPYPQHSDRQVLAYAVREQQLKLPKPQLQLALSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGTTELEEEF

  • Molecular Weight

    Approximately 71 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00