AATK Protein, Mouse (sf9, GST)
AATK Protein, Mouse (sf9, GST) is the recombinant mouse-derived AATK, expressed by Sf9 insect cells, with GST labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AATK Protein, Mouse (sf9, GST) is the recombinant mouse-derived AATK, expressed by Sf9 insect cells, with GST labeled tag.
Background
AATK may be involved in neuronal differentiation. by similar: Its function is potentially associated with neural development.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag GST
-
Accession
Q80YE4-1 (P8-F411)
-
Gene ID11302
-
Protein Length
Partial
-
Synonyms
AATK; Protein Phosphatase 1, Regulatory Subunit 77; Apoptosis Associated Tyrosine Kinase; Brain Apoptosis-Associated Tyrosine Kinase; AATYK; Serine/Threonine-Protein Kinase LMTK1; LMTK1; CDK5-Binding Protein; LMR1; P35-Binding Protein; Lemur Tyrosine Kina
-
AA Sequence
PSFAFSSHFDPDGAPLSELSWSSSLAVVAVSFSGIFTVVILMLACLCCKKGGIGFKEFENAEGDEYVADFSEQGSPAAAAQTGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDLGRHSLLYLKEIGHGWFGKVFLGEVHSGVSGTQVVVKELKVSASVQEQMQFLEEAQPYRALQHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVTESMAPDPLTLQRMACEVACGVLHLHRHNYVHSDLALRNCLLTADLTVKVGDYGLSHCKYREDYLVTADQLWVPLRWIAPELVDEVHGNLLVVDQTKSSNVWSLGVTIWELFELGAQPYPQHSDRQVLAYAVREQQLKLPKPQLQLALSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGTTELEEEF
-
Molecular Weight
Approximately 71 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
