ABHD14B Protein, Human (His)
Based on 1 Customer Validation
ABHD14B Protein, identified as an atypical protein-lysine deacetylase, catalyzes lysine deacetylation using CoA as a substrate in vitro, generating acetyl-CoA and free amine. Although confirmation of in vivo deacetylase activity is needed, ABHD14B also exhibits hydrolase activity toward various p-nitrophenyl substrates. It may potentially activate transcription. ABHD14B Protein, Human (His) is the recombinant human-derived ABHD14B protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ABHD14B Protein, identified as an atypical protein-lysine deacetylase, catalyzes lysine deacetylation using CoA as a substrate in vitro, generating acetyl-CoA and free amine. Although confirmation of in vivo deacetylase activity is needed, ABHD14B also exhibits hydrolase activity toward various p-nitrophenyl substrates. It may potentially activate transcription. ABHD14B Protein, Human (His) is the recombinant human-derived ABHD14B protein, expressed by E. coli , with N-6*His labeled tag.
Background
ABHD14B exhibits atypical protein-lysine deacetylase activity in vitro, facilitating the deacetylation of lysine residues using CoA as a substrate and generating acetyl-CoA along with the free amine of protein-lysine residues. While further experiments are needed to validate its protein-lysine deacetylase activity in vivo, the enzyme also demonstrates hydrolase activity towards various surrogate p-nitrophenyl (pNp) substrates, with a pronounced preference for pNp-acetate. Additionally, ABHD14B may play a role in transcriptional activation, highlighting its potential involvement in cellular processes related to acetylation and hydrolysis.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q96IU4-1 (M1-Q210)
-
Molecular Construction
-
N-term
-
6*His
-
ABHD14B (M1-Q210)
Accession # Q96IU4-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ABHD14B; CCG1-Interacting Factor B; Abhydrolase Domain Containing 14B; MGC15429; CIB; Epididymis Secretory Sperm Binding Protein; Alpha/Beta Hydrolase Domain-Containing Protein 14B; Cell Cycle Gene 1-Interacting Factor B; Putative Protein-Lysine Deacylase
-
AA Sequence
MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
