ABHD14B Protein, Human (His)
Based on 1 Customer Validation
ABHD14B Protein, identified as an atypical protein-lysine deacetylase, catalyzes lysine deacetylation using CoA as a substrate in vitro, generating acetyl-CoA and free amine. Although confirmation of in vivo deacetylase activity is needed, ABHD14B also exhibits hydrolase activity toward various p-nitrophenyl substrates. It may potentially activate transcription. ABHD14B Protein, Human (His) is the recombinant human-derived ABHD14B protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ABHD14B Protein, identified as an atypical protein-lysine deacetylase, catalyzes lysine deacetylation using CoA as a substrate in vitro, generating acetyl-CoA and free amine. Although confirmation of in vivo deacetylase activity is needed, ABHD14B also exhibits hydrolase activity toward various p-nitrophenyl substrates. It may potentially activate transcription. ABHD14B Protein, Human (His) is the recombinant human-derived ABHD14B protein, expressed by E. coli , with N-6*His labeled tag.
ABHD14B exhibits atypical protein-lysine deacetylase activity in vitro, facilitating the deacetylation of lysine residues using CoA as a substrate and generating acetyl-CoA along with the free amine of protein-lysine residues. While further experiments are needed to validate its protein-lysine deacetylase activity in vivo, the enzyme also demonstrates hydrolase activity towards various surrogate p-nitrophenyl (pNp) substrates, with a pronounced preference for pNp-acetate. Additionally, ABHD14B may play a role in transcriptional activation, highlighting its potential involvement in cellular processes related to acetylation and hydrolysis.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q96IU4-1 (M1-Q210)
-
Molecular Construction
-
N-term
-
6*His
-
ABHD14B (M1-Q210)
Accession # Q96IU4-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ABHD14B; CCG1-Interacting Factor B; Abhydrolase Domain Containing 14B; MGC15429; CIB; Epididymis Secretory Sperm Binding Protein; Alpha/Beta Hydrolase Domain-Containing Protein 14B; Cell Cycle Gene 1-Interacting Factor B; Putative Protein-Lysine Deacylase
-
AA Sequence
MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
