ABHD4 Protein, Human (sf9, His)
ABHD4 is a lysophospholipase that acts selectively on N-acylphosphatidylethanolamines (NAPE), which is essential for the biosynthesis of N-acylphosphatidylethanolamines such as anandamide. It hydrolyzes the sn-1 and sn-2 acyl chains in NAPE to generate glycerophosphate-N-acylethanolamine (GP-NAE), which is an important intermediate in the production of N-acylethanolamine. ABHD4 Protein, Human (sf9, His) is the recombinant human-derived ABHD4 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ABHD4 is a lysophospholipase that acts selectively on N-acylphosphatidylethanolamines (NAPE), which is essential for the biosynthesis of N-acylphosphatidylethanolamines such as anandamide. It hydrolyzes the sn-1 and sn-2 acyl chains in NAPE to generate glycerophosphate-N-acylethanolamine (GP-NAE), which is an important intermediate in the production of N-acylethanolamine. ABHD4 Protein, Human (sf9, His) is the recombinant human-derived ABHD4 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
ABHD4, a lysophospholipase, exhibits selectivity for N-acyl phosphatidylethanolamine (NAPE) and plays a vital role in the biosynthesis of N-acyl ethanolamines, such as the endocannabinoid anandamide. It achieves this by hydrolyzing the sn-1 and sn-2 acyl chains from NAPE, generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate crucial for N-acyl ethanolamine biosynthesis. ABHD4 demonstrates activity across a range of substrates with saturated, monounsaturated, and polyunsaturated N-acyl chains, contributing to the diversity of N-acyl ethanolamines produced. Notably, it exhibits no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine, and lysophosphatidylserine.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
Q8TB40 (M1-D342)
-
Molecular Construction
-
N-term
-
His
-
ABHD4 (M1-D342)
Accession # Q8TB40 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ABHD4; FLJ12816; Abhydrolase Domain Containing 4, N-Acyl Phospholipase B; Lyso-N-Acylphosphatidylethanolamine Lipase; Alpha/Beta Hydrolase Domain-Containing Protein 4; Abhydrolase Domain Containing 4; (Lyso)-N-Acylphosphatidylethanolamine Lipase; Protein
-
AA Sequence
MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD
-
Predicted Molecular Mass
41 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
