1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. ABHD4 Protein, Human (sf9, His)

ABHD4 is a lysophospholipase that acts selectively on N-acylphosphatidylethanolamines (NAPE), which is essential for the biosynthesis of N-acylphosphatidylethanolamines such as anandamide. It hydrolyzes the sn-1 and sn-2 acyl chains in NAPE to generate glycerophosphate-N-acylethanolamine (GP-NAE), which is an important intermediate in the production of N-acylethanolamine. ABHD4 Protein, Human (sf9, His) is the recombinant human-derived ABHD4 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ABHD4 is a lysophospholipase that acts selectively on N-acylphosphatidylethanolamines (NAPE), which is essential for the biosynthesis of N-acylphosphatidylethanolamines such as anandamide. It hydrolyzes the sn-1 and sn-2 acyl chains in NAPE to generate glycerophosphate-N-acylethanolamine (GP-NAE), which is an important intermediate in the production of N-acylethanolamine. ABHD4 Protein, Human (sf9, His) is the recombinant human-derived ABHD4 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

ABHD4, a lysophospholipase, exhibits selectivity for N-acyl phosphatidylethanolamine (NAPE) and plays a vital role in the biosynthesis of N-acyl ethanolamines, such as the endocannabinoid anandamide. It achieves this by hydrolyzing the sn-1 and sn-2 acyl chains from NAPE, generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate crucial for N-acyl ethanolamine biosynthesis. ABHD4 demonstrates activity across a range of substrates with saturated, monounsaturated, and polyunsaturated N-acyl chains, contributing to the diversity of N-acyl ethanolamines produced. Notably, it exhibits no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine, and lysophosphatidylserine.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

Q8TB40 (M1-D342)

Gene ID
Molecular Construction
N-term
His
ABHD4 (M1-D342)
Accession # Q8TB40
C-term
Protein Length

Full Length

Synonyms
(Lyso)-N-acylphosphatidylethanolamine lipase; Alpha/beta-hydrolase 4; ABHD4
AA Sequence

MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD

Predicted Molecular Mass
41 kDa
Molecular Weight

Approximately 40 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ABHD4 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ABHD4 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ABHD4 Protein, Human (sf9, His)
Cat. No.:
HY-P76133
Quantity:
MCE Japan Authorized Agent: