Copy Link Print Information

ADAM12 Protein, Human (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

ADAM12 Protein significantly contributes to skeletal muscle regeneration, particularly in initiating cell fusion. Its multifaceted involvement extends to forming macrophage-derived giant cells (MGC) and differentiating osteoclasts from mononuclear precursors, showcasing a broader role beyond muscle regeneration. ADAM12 Protein, Human (HEK293, His, solution) is the recombinant human-derived ADAM12 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • ADAM12 Protein, Human (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ADAM12 Protein significantly contributes to skeletal muscle regeneration, particularly in initiating cell fusion. Its multifaceted involvement extends to forming macrophage-derived giant cells (MGC) and differentiating osteoclasts from mononuclear precursors, showcasing a broader role beyond muscle regeneration. ADAM12 Protein, Human (HEK293, His, solution) is the recombinant human-derived ADAM12 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

ADAM12 protein plays a significant role in skeletal muscle regeneration, particularly during the initiation of cell fusion processes. Additionally, it is implicated in the formation of macrophage-derived giant cells (MGC) and the differentiation of osteoclasts from mononuclear precursors, highlighting its multifaceted involvement in cellular events beyond muscle regeneration.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized ADAM12 Protein, Human (HEK293, His) at 10 μg/mL (100 μl/well) can bind mouse FLRG-His with a linear range of 0.31-1.25 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    O43184 (R29-S513)

  • Gene ID
    8038
  • Molecular Construction
    • N-term
    • ADAM12 (R29-S513)
      Accession # O43184
    • 10*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ADAM12; Metalloprotease-Disintegrin 12 Transmembrane; ADAM Metallopeptidase Domain 12; Meltrin Alpha; MLTN; ADAM12-OT1; MCMPMltna; ADAM 12; Disintegrin And Metalloproteinase Domain-Containing Protein 12; CAR10; Meltrin-Alpha; MLTNA; A Disintegrin And Meta

  • AA Sequence

    RGVSLWNQGRADEVVSASVGSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCYYHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRESFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGTACRDSSNSCDLPEFCTGASPHCPANVYLHDGHS

  • Predicted Molecular Mass

    55.2 kDa

  • Molecular Weight

    Approximately 27 kDa (propeptide) & 55 kDa (mature form) & 72 kDa (pro form), based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ADAM12 Protein, Human (HEK293, His, solution) Product Image
    1/16
  • ADAM12 Protein, Human (HEK293, His, solution) Product Image