ADAM12 Protein, Human (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

ADAM12 Protein significantly contributes to skeletal muscle regeneration, particularly in initiating cell fusion. Its multifaceted involvement extends to forming macrophage-derived giant cells (MGC) and differentiating osteoclasts from mononuclear precursors, showcasing a broader role beyond muscle regeneration. ADAM12 Protein, Human (HEK293, His, solution) is the recombinant human-derived ADAM12 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ADAM12 Protein significantly contributes to skeletal muscle regeneration, particularly in initiating cell fusion. Its multifaceted involvement extends to forming macrophage-derived giant cells (MGC) and differentiating osteoclasts from mononuclear precursors, showcasing a broader role beyond muscle regeneration. ADAM12 Protein, Human (HEK293, His, solution) is the recombinant human-derived ADAM12 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

ADAM12 protein plays a significant role in skeletal muscle regeneration, particularly during the initiation of cell fusion processes. Additionally, it is implicated in the formation of macrophage-derived giant cells (MGC) and the differentiation of osteoclasts from mononuclear precursors, highlighting its multifaceted involvement in cellular events beyond muscle regeneration.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized ADAM12 Protein, Human (HEK293, His) at 10 μg/mL (100 μl/well) can bind mouse FLRG-His with a linear range of 0.31-1.25 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ADAM12 (R29-S513)
      Accession # O43184
    • 10*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ADAM12; Metalloprotease-Disintegrin 12 Transmembrane; ADAM Metallopeptidase Domain 12; Meltrin Alpha; MLTN; ADAM12-OT1; MCMPMltna; ADAM 12; Disintegrin And Metalloproteinase Domain-Containing Protein 12; CAR10; Meltrin-Alpha; MLTNA; A Disintegrin And Meta

  • AA Sequence

    RGVSLWNQGRADEVVSASVGSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCYYHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRESFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGTACRDSSNSCDLPEFCTGASPHCPANVYLHDGHS

  • Predicted Molecular Mass

    55.2 kDa

  • Molecular Weight

    Approximately 27 kDa (propeptide) & 55 kDa (mature form) & 72 kDa (pro form), based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00