ADAM8 Protein, Human (481a.a, HEK293, His)
ADAM8 Protein, Human (481a.a, HEK293, His) is the recombinant human-derived ADAM8 protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ADAM8 Protein, Human (481a.a, HEK293, His) is the recombinant human-derived ADAM8 protein, expressed by HEK293, with C-His tag.
Background
ADAM8 protein is speculated to participate in the process of leukocyte extravasation, implying its potential role in facilitating the migration of white blood cells from blood vessels into surrounding tissues. This suggests that ADAM8 may contribute to immune responses by regulating the movement of leukocytes across the endothelial barrier, an essential step in the inflammatory and immune surveillance processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
AAI15405.1 (I17-P497)
-
Gene ID101
-
Molecular Construction
-
N-term
-
ADAM8 (I17-P497)
Accession # P78325 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ADAM8; Cell Surface Antigen MS2; ADAM Metallopeptidase Domain 8; CDNA, FLJ93272, Highly Similar To Homo Sapiens A Disintegrin And Metalloproteinase Domain 8 (ADAM8),MRNA; MS2; Human Leukocyte Differentiation Antigen; CD156A; CD156a Antigen; CD156; ADAM8 P
-
AA Sequence
IAPSRPWALMEQYEVVLPRRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAASLSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCDGRHPECPEDAFQENGTP
-
Predicted Molecular Mass
53.8 kDa
-
Molecular Weight
Approximately 57-65 kDa & 35-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
