ADAM9 Protein, Mouse (Biotinylated, HEK293, His-Avi)
ADAM9 protein is a metalloprotease that plays an important role in tumorigenesis and angiogenesis. It cleaves TEK, KDR, EPHB4, CD40, VCAM1 and CDH5, regulating cancer-related signaling pathways and blood vessel formation. ADAM9, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived ADAM9 protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
ADAM9 protein is a metalloprotease that plays an important role in tumorigenesis and angiogenesis. It cleaves TEK, KDR, EPHB4, CD40, VCAM1 and CDH5, regulating cancer-related signaling pathways and blood vessel formation. ADAM9, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived ADAM9 protein, expressed by HEK293, with N-Avi labeled tag.
Background
ADAM9 Protein, a metalloprotease, is implicated in crucial cellular processes associated with tumorigenesis and angiogenesis. This multifaceted enzyme is known to cleave and release various molecules, including TEK, KDR, EPHB4, CD40, VCAM1, and CDH5, highlighting its involvement in modulating key signaling pathways relevant to cancer progression and blood vessel formation. Beyond its role in proteolytic events, ADAM9 is suggested to play a part in mediating cell-cell and cell-matrix interactions, thereby contributing to the regulation of cellular motility, potentially through interactions with integrins. This diverse range of molecular interactions underscores the significance of ADAM9 in influencing cellular behavior and its potential impact on pathological processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q61072 (A206-D697)
-
Gene ID11502
-
Molecular Construction
-
N-term
-
ADAM9 (A206-D697)
Accession # Q61072 -
His-Avi
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
ADAM9; Myeloma Cell Metalloproteinase; Prev. CORD9; A Disintegrin And Metalloproteinase Domain 9 (Meltrin Gamma); MDC9; ADAM Metallopeptidase Domain 9 (Meltrin Gamma); MCMP; Meltrin Gamma; KIAA0021; Meltrin-Gamma; Mltng; ADAM9 Protein; Disintegrin And Met
-
AA Sequence
AVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMIRLANYLDSMYIMLNIRIVLVGLEIWTDRNPINIIGGAGDVLGNFVQWREKFLITRWRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRECFCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGSCLLNIPKPDEAYSAPSCGNKLVDPGEECDCGTAKECEVDPCCEGSTCKLKSFAECAYGDCCKDCQFLPGGSMCRGKTSECDVPEYCNGSSQFCPPDVFIQNGYPCQNSKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCFIEVNSKGDRFGNCGFSGSEYKKCATGNALCGKLQCENVQDMPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCDAGKICRNFQCVNASVLNYDCDIQGKCHGHGVCNSNKNCHCEDGWAPPHCDTKGYGGSVDSGPTYNAKSTALRD
-
Predicted Molecular Mass
56.9 kDa
-
Molecular Weight
Approximately 65-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
/
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)