ADAM9 Protein, Mouse (Biotinylated, HEK293, His-Avi)

ADAM9 protein is a metalloprotease that plays an important role in tumorigenesis and angiogenesis. It cleaves TEK, KDR, EPHB4, CD40, VCAM1 and CDH5, regulating cancer-related signaling pathways and blood vessel formation. ADAM9, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived ADAM9 protein, expressed by HEK293, with N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ADAM9 protein is a metalloprotease that plays an important role in tumorigenesis and angiogenesis. It cleaves TEK, KDR, EPHB4, CD40, VCAM1 and CDH5, regulating cancer-related signaling pathways and blood vessel formation. ADAM9, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived ADAM9 protein, expressed by HEK293, with N-Avi labeled tag.

Background

ADAM9 Protein, a metalloprotease, is implicated in crucial cellular processes associated with tumorigenesis and angiogenesis. This multifaceted enzyme is known to cleave and release various molecules, including TEK, KDR, EPHB4, CD40, VCAM1, and CDH5, highlighting its involvement in modulating key signaling pathways relevant to cancer progression and blood vessel formation. Beyond its role in proteolytic events, ADAM9 is suggested to play a part in mediating cell-cell and cell-matrix interactions, thereby contributing to the regulation of cellular motility, potentially through interactions with integrins. This diverse range of molecular interactions underscores the significance of ADAM9 in influencing cellular behavior and its potential impact on pathological processes.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ADAM9 (A206-D697)
      Accession # Q61072
    • His-Avi
    • C-term
  • Protein Length

    Partial

  • Conjugation

    Biotin

  • Synonyms

    ADAM9; Myeloma Cell Metalloproteinase; Prev. CORD9; A Disintegrin And Metalloproteinase Domain 9 (Meltrin Gamma); MDC9; ADAM Metallopeptidase Domain 9 (Meltrin Gamma); MCMP; Meltrin Gamma; KIAA0021; Meltrin-Gamma; Mltng; ADAM9 Protein; Disintegrin And Met

  • AA Sequence

    AVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMIRLANYLDSMYIMLNIRIVLVGLEIWTDRNPINIIGGAGDVLGNFVQWREKFLITRWRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRECFCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGSCLLNIPKPDEAYSAPSCGNKLVDPGEECDCGTAKECEVDPCCEGSTCKLKSFAECAYGDCCKDCQFLPGGSMCRGKTSECDVPEYCNGSSQFCPPDVFIQNGYPCQNSKAYCYNGMCQYYDAQCQVIFGSKAKAAPRDCFIEVNSKGDRFGNCGFSGSEYKKCATGNALCGKLQCENVQDMPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCDAGKICRNFQCVNASVLNYDCDIQGKCHGHGVCNSNKNCHCEDGWAPPHCDTKGYGGSVDSGPTYNAKSTALRD

  • Predicted Molecular Mass

    56.9 kDa

  • Molecular Weight

    Approximately 65-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

/

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00