1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. ADH2 Protein, Geobacillus thermodenitrificans

ADH2 Protein, Geobacillus thermodenitrificans

Cat. No.: HY-P703457
Handling Instructions Technical Support

ADH2 Protein, Geobacillus thermodenitrificans is the recombinant ADH2, expressed by E. coli, with tag free labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ADH2 Protein, Geobacillus thermodenitrificans is the recombinant ADH2, expressed by E. coli, with tag free labeled tag.

Background

ADH2 is a long-chain alkyl alcohol dehydrogenase capable of oxidizing a broad range of alkyl alcohols from methanol to 1-triacontanol (C1 to C30), as well as 1,3-propanediol and acetaldehyde. It also oxidizes isopropyl alcohol, isoamylol, acetone, octanal, and decanal. The best substrate is 1-octanol. by similar: The enzyme exhibits catalytic activity toward other substrates such as isopropyl alcohol and isoamylol.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

A4ISB9 (Q2-L387)

Gene ID

87623025

Protein Length

Full Length

Synonyms
Long-chain-alcohol dehydrogenase 2; Alcohol dehydrogenase 2; ADH2; Fatty alcohol oxidoreductase 2; adh2; Geobacillus thermodenitrificans (strain NG80-2); ADH2; Oxidoreductase; 1.1.1.192
AA Sequence

QNFTFRNPTKLIFGRGQIEQLKEEVPKYGKKVLLVYGGGSIKRNGLYDEVMSLLTDIGAEVVELPGVEPNPRLSTVKKGVDICRREGIEFLLAVGGGSVIDCTKAIAAGAKFDGDPWEFITKKATVTEALPFGTVLTLAATGSEMNAGSVITNWETKEKYGWGSPVTFPQFSILDPTYTMTVPKDHTVYGIVDMMSHVFEQYFHHTPNTPLQDRMCEAVLKTVIEAAPKLVDDLENYELRETIMYSGTIALNGFLQMGVRGDWATHDIEHAVSAVYDIPHAGGLAILFPNWMKHVLDENVSRFAQLAVRVFDVDPTGKTERDVALEGIERLRAFWSSLGAPSRLADYGIGEENLELMADKAMAFGEFGRFKTLNRDDVLAILRASL

Predicted Molecular Mass
42.8 kDa
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ADH2 Protein, Geobacillus thermodenitrificans Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ADH2 Protein, Geobacillus thermodenitrificans

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADH2 Protein, Geobacillus thermodenitrificans
Cat. No.:
HY-P703457
Quantity:
MCE Japan Authorized Agent: