ADH2 Protein, Geobacillus thermodenitrificans
ADH2 Protein, Geobacillus thermodenitrificans is the recombinant ADH2, expressed by E. coli, with tag free labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ADH2 Protein, Geobacillus thermodenitrificans is the recombinant ADH2, expressed by E. coli, with tag free labeled tag.
Background
ADH2 is a long-chain alkyl alcohol dehydrogenase capable of oxidizing a broad range of alkyl alcohols from methanol to 1-triacontanol (C1 to C30), as well as 1,3-propanediol and acetaldehyde. It also oxidizes isopropyl alcohol, isoamylol, acetone, octanal, and decanal. The best substrate is 1-octanol. by similar: The enzyme exhibits catalytic activity toward other substrates such as isopropyl alcohol and isoamylol.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
A4ISB9 (Q2-L387)
-
Gene ID87623025
-
Protein Length
Full Length
-
Synonyms
ADH1B; Alcohol Dehydrogenase 2 (Class I), Beta Polypeptide; Prev. ADH2; Aldehyde Reductase; All-Trans-Retinol Dehydrogenase [NAD(+)] ADH1B; ADH, Beta Subunit; Epididymis Secretory Protein Li 117; HEL-S-117; Alcohol Dehydrogenase Subunit Beta; Alcohol Dehy
-
AA Sequence
QNFTFRNPTKLIFGRGQIEQLKEEVPKYGKKVLLVYGGGSIKRNGLYDEVMSLLTDIGAEVVELPGVEPNPRLSTVKKGVDICRREGIEFLLAVGGGSVIDCTKAIAAGAKFDGDPWEFITKKATVTEALPFGTVLTLAATGSEMNAGSVITNWETKEKYGWGSPVTFPQFSILDPTYTMTVPKDHTVYGIVDMMSHVFEQYFHHTPNTPLQDRMCEAVLKTVIEAAPKLVDDLENYELRETIMYSGTIALNGFLQMGVRGDWATHDIEHAVSAVYDIPHAGGLAILFPNWMKHVLDENVSRFAQLAVRVFDVDPTGKTERDVALEGIERLRAFWSSLGAPSRLADYGIGEENLELMADKAMAFGEFGRFKTLNRDDVLAILRASL
-
Predicted Molecular Mass
42.8 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
