ADORA2A Protein-VLP, Human (HEK293)
ADORA2A Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
ADORA2A Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
Background
The ADORA2A Protein-VLP, functioning as a receptor for adenosine, operates through G proteins to activate adenylyl cyclase. Its cytoplasmic C-terminal domain interacts directly with USP4 and GAS2L2, suggesting potential regulatory roles in cellular processes. Additionally, ADORA2A Protein-VLP may interact with DRD4 and NECAB2, further indicating its involvement in diverse cellular signaling pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P29274 (M1-S412)
-
Molecular Construction
-
N-term
-
ADORA2A-VLP (M1-S412)
Accession # P29274 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ADORA2A; Adenosine Receptor A2a; Prev. ADORA2; Adenosine Receptor A2; RDC8; A2aR; Adenosine A2a Receptor; Adenosine Receptor Subtype A2a
-
AA Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
-
Glycosylation
Yes
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)