AIFM2 Protein, Human (Strep)

Customer Review

Based on 1 Customer Validation

AIFM2 Protein, Human (Strep II) is the recombinant human-derived AIFM2, expressed by E. coli, with Strep II labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

AIFM2 Protein, Human (Strep II) is the recombinant human-derived AIFM2, expressed by E. coli, with Strep II labeled tag.

Background

AIFM2 is a NAD(P)H-dependent oxidoreductase that serves as a key inhibitor of ferroptosis. At the plasma membrane, it catalyzes the reduction of coenzyme Q/ubiquinone-10 to ubiquinol-10, a lipophilic radical-trapping antioxidant that prevents lipid oxidative damage and subsequent ferroptosis. It acts in parallel with GPX4 to suppress phospholipid peroxidation and ferroptosis, with this anti-ferroptotic function being independent of cellular glutathione levels. Additionally, AIFM2 functions as a potent radical-trapping antioxidant by mediating warfarin-resistant vitamin K reduction in the canonical vitamin K cycle: it catalyzes NAD(P)H-dependent reduction of vitamin K (phylloquinone, menaquinone-4, and menadione) to hydroquinone forms, which act as potent inhibitors of phospholipid peroxidation and ferroptosis. AIFM2 may participate in mitochondrial stress signaling: under oxidative stress, it associates with the lipid peroxidation end product 4-hydroxy-2-nonenal (HNE) to form a lipid adduct lacking oxidoreductase activity, which then translocates from mitochondria to the nucleus, triggering DNA damage and cell death. It is also capable of non-sequence-specific DNA binding.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-StrepⅡ
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FSP1; AMID; PRG3

  • AA Sequence

    GSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

  • Molecular Weight

    Approximately 41 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00