AIFM2 Protein, Human (Strep)
Based on 1 Customer Validation
AIFM2 Protein, Human (Strep II) is the recombinant human-derived AIFM2, expressed by E. coli, with Strep II labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
AIFM2 Protein, Human (Strep II) is the recombinant human-derived AIFM2, expressed by E. coli, with Strep II labeled tag.
Background
AIFM2 is a NAD(P)H-dependent oxidoreductase that serves as a key inhibitor of ferroptosis. At the plasma membrane, it catalyzes the reduction of coenzyme Q/ubiquinone-10 to ubiquinol-10, a lipophilic radical-trapping antioxidant that prevents lipid oxidative damage and subsequent ferroptosis. It acts in parallel with GPX4 to suppress phospholipid peroxidation and ferroptosis, with this anti-ferroptotic function being independent of cellular glutathione levels. Additionally, AIFM2 functions as a potent radical-trapping antioxidant by mediating warfarin-resistant vitamin K reduction in the canonical vitamin K cycle: it catalyzes NAD(P)H-dependent reduction of vitamin K (phylloquinone, menaquinone-4, and menadione) to hydroquinone forms, which act as potent inhibitors of phospholipid peroxidation and ferroptosis. AIFM2 may participate in mitochondrial stress signaling: under oxidative stress, it associates with the lipid peroxidation end product 4-hydroxy-2-nonenal (HNE) to form a lipid adduct lacking oxidoreductase activity, which then translocates from mitochondria to the nucleus, triggering DNA damage and cell death. It is also capable of non-sequence-specific DNA binding.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-StrepⅡ
-
Accession
Q9BRQ8-1 (G2-P373)
-
Gene ID84883
-
Protein Length
Full Length of Isoform-1
-
Synonyms
AIFM2; Apoptosis Inducing Factor Mitochondria Associated 2; Prev. AMID; P53-Responsive Gene 3 Protein; PRG3; Ferroptosis Suppressor 1; FSP1; FLJ14497; AIF Family Member 2; Apoptosis-Inducing Factor Homologous Mitochondrion-Associated Inducer Of Death; Apo
-
AA Sequence
GSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
-
Molecular Weight
Approximately 41 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)