AIMP2 Protein, Human (His)
AIMP2 Protein, Human (His) plays a primary role in the initiation of α-synuclein (aSyn) aggregation.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
AIMP2 Protein, Human (His) plays a primary role in the initiation of α-synuclein (aSyn) aggregation.
Background
Aminoacyl-tRNA synthetase complex interacting multifunctional protein-2 (AIMP2), which has been reported to cause selective and age-dependent degeneration of dopaminergic neurons, plays an essential role in the initiation of aSyn fibrillization and LB formation. AIMP2 first self-assembles to form amyloid-like aggregates, which interact with monomeric aSyn and induce its fibrillization in vitro as well as the formation of aSyn fibrils and LB-like inclusions in various well-established cellular and animal models of synucleinopathies. AIMP2 is part of the multiaminoacyl-tRNA synthetase complex, where it acts as a scaffold subunit to stabilize the whole complex. This complex plays a pivotal role in protein biosynthesis by catalyzing the esterification of amino acids with their corresponding tRNA. In this regard, its function suggests that it possess multiple protein-protein interaction surfaces[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q13155 (M1-K320)
-
Molecular Construction
-
N-term
-
His
-
AIMP2 (M1-K320)
Accession # Q13155 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
AIMP2; JTV-1; Aminoacyl TRNA Synthetase Complex Interacting Multifunctional Protein 2; P38; JTV1; Multisynthetase Complex Auxiliary Component P38; Aminoacyl TRNA Synthase Complex-Interacting Multifunctional Protein 2; PRO0992; Multisynthase Complex Auxili
-
AA Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK
-
Predicted Molecular Mass
39.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)