AIMP2 Protein, Human (His)

AIMP2 Protein, Human (His) plays a primary role in the initiation of α-synuclein (aSyn) aggregation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

AIMP2 Protein, Human (His) plays a primary role in the initiation of α-synuclein (aSyn) aggregation.

Background

Aminoacyl-tRNA synthetase complex interacting multifunctional protein-2 (AIMP2), which has been reported to cause selective and age-dependent degeneration of dopaminergic neurons, plays an essential role in the initiation of aSyn fibrillization and LB formation. AIMP2 first self-assembles to form amyloid-like aggregates, which interact with monomeric aSyn and induce its fibrillization in vitro as well as the formation of aSyn fibrils and LB-like inclusions in various well-established cellular and animal models of synucleinopathies. AIMP2 is part of the multiaminoacyl-tRNA synthetase complex, where it acts as a scaffold subunit to stabilize the whole complex. This complex plays a pivotal role in protein biosynthesis by catalyzing the esterification of amino acids with their corresponding tRNA. In this regard, its function suggests that it possess multiple protein-protein interaction surfaces[1].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • AIMP2 (M1-K320)
      Accession # Q13155
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    AIMP2; JTV-1; Aminoacyl TRNA Synthetase Complex Interacting Multifunctional Protein 2; P38; JTV1; Multisynthetase Complex Auxiliary Component P38; Aminoacyl TRNA Synthase Complex-Interacting Multifunctional Protein 2; PRO0992; Multisynthase Complex Auxili

  • AA Sequence

    MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK

  • Predicted Molecular Mass

    39.3 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00