aKMT Protein, Sulfolobus islandicus
Lysine methyltransferase (aKMT) is responsible for catalyzing the methylation of lysine residues in target proteins, using S-adenosyl-L-methionine (SAM) as a methyl donor. The enzyme exhibits broad substrate specificity, showing methylation primarily at "Lys-11", "Lys-16" and "Lys-31" of the vault chromatin protein Cren7 as well as several recombinant Sulfolobus proteins in vitro Ability. aKMT Protein, Sulfolobus islandicus is the recombinant aKMT protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Lysine methyltransferase (aKMT) is responsible for catalyzing the methylation of lysine residues in target proteins, using S-adenosyl-L-methionine (SAM) as a methyl donor. The enzyme exhibits broad substrate specificity, showing methylation primarily at "Lys-11", "Lys-16" and "Lys-31" of the vault chromatin protein Cren7 as well as several recombinant Sulfolobus proteins in vitro Ability. aKMT Protein, Sulfolobus islandicus is the recombinant aKMT protein, expressed by E. coli , with tag free.
Background
The aKMT protein functions as a lysine methyltransferase, catalyzing the methylation of lysine residues in target proteins. This enzymatic activity is accomplished using S-adenosyl-L-methionine (SAM) as the methyl donor. aKMT displays broad substrate specificity and has the capability to methylate various target proteins. In particular, it has been observed to methylate the crenarchaeal chromatin protein Cren7 at specific lysine residues, including 'Lys-11,' 'Lys-16,' and 'Lys-31.' Additionally, aKMT exhibits sequence-independent lysine methylation, showcasing its versatility in modifying a range of target proteins in vitro.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
F0NBH8 (S2-K161)
-
Gene ID8761611
-
Molecular Construction
-
N-term
-
aKMT (S2-K161)
Accession # F0NBH8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Protein-lysine N-methyltransferase; EC:2.1.1.-; Archaeal protein lysine methyltransferase; SiRe_1449; aKMT
-
AA Sequence
SYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYDLGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
