aKMT Protein, Sulfolobus islandicus

Lysine methyltransferase (aKMT) is responsible for catalyzing the methylation of lysine residues in target proteins, using S-adenosyl-L-methionine (SAM) as a methyl donor. The enzyme exhibits broad substrate specificity, showing methylation primarily at "Lys-11", "Lys-16" and "Lys-31" of the vault chromatin protein Cren7 as well as several recombinant Sulfolobus proteins in vitro Ability. aKMT Protein, Sulfolobus islandicus is the recombinant aKMT protein, expressed by E. coli , with tag free.

The aKMT protein functions as a lysine methyltransferase, catalyzing the methylation of lysine residues in target proteins. This enzymatic activity is accomplished using S-adenosyl-L-methionine (SAM) as the methyl donor. aKMT displays broad substrate specificity and has the capability to methylate various target proteins. In particular, it has been observed to methylate the crenarchaeal chromatin protein Cren7 at specific lysine residues, including 'Lys-11,' 'Lys-16,' and 'Lys-31.' Additionally, aKMT exhibits sequence-independent lysine methylation, showcasing its versatility in modifying a range of target proteins in vitro.

Others

E. coli

Tag Free

F0NBH8 (S2-K161)

8761611

Full Length

SYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYDLGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHK

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.