Copy Link Print Information

AMELX Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

AMELX Protein plays a central role in biomineralization, shaping crystallite formation during the secretory stage of tooth enamel development. Its pivotal function extends to structurally organizing and mineralizing developing enamel, emphasizing its significance in dental tissue architecture. Interactions with KRT5 suggest its involvement in molecular networks contributing to the orchestrated development and mineralization of tooth enamel. AMELX Protein, Human (His-SUMO) is the recombinant human-derived AMELX protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • AMELX Protein, Human (His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

AMELX Protein plays a central role in biomineralization, shaping crystallite formation during the secretory stage of tooth enamel development. Its pivotal function extends to structurally organizing and mineralizing developing enamel, emphasizing its significance in dental tissue architecture. Interactions with KRT5 suggest its involvement in molecular networks contributing to the orchestrated development and mineralization of tooth enamel. AMELX Protein, Human (His-SUMO) is the recombinant human-derived AMELX protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

AMELX takes center stage in the intricate process of biomineralization, exerting its influence on the formation of crystallites during the secretory stage of tooth enamel development. Its pivotal role extends to the structural organization and mineralization of developing enamel, emphasizing its significance in shaping the intricate architecture of dental tissues. Furthermore, AMELX engages in interactions with KRT5, suggesting its involvement in intricate molecular networks that contribute to the orchestrated development and mineralization of tooth enamel.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession

    Q99217 (M17-D191)

  • Gene ID
    265  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • AMELX (M17-D191)
      Accession # Q99217
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    AMELX; Amelogenin (Amelogenesis Imperfecta 1, X-Linked); Prev. AMG; Amelogenin; Prev. AIH1; AI1E; Amelogenin (X Chromosome, Amelogenesis Imperfecta 1); ALGN; Amelogenin, X Isoform; AMGL; AMGX; Amelogenin X-Linked; Amelogenesis Imperfecta 1

  • AA Sequence

    MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

  • Predicted Molecular Mass

    35.9 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • AMELX Protein, Human (His-SUMO) Product Image
    1/16
  • AMELX Protein, Human (His-SUMO) Product Image