AMHR2/MISRII Protein, Mouse (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate signaling cascades by phosphorylating and activating type I receptors, which undergo autophosphorylation. AMHR2/MISRII Protein, Mouse (HEK293, His) is the recombinant mouse-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag.

Upon binding its ligand, AMHR2/MISRII Protein orchestrates the assembly of a receptor complex comprising two type II and two type I transmembrane serine/threonine kinases. The type II receptors initiate the signaling cascade by phosphorylating and activating the type I receptors, which, in turn, undergo autophosphorylation. Subsequently, these activated type I receptors engage with and activate SMAD transcriptional regulators, culminating in the modulation of downstream gene expression. Notably, AMHR2/MISRII serves as the receptor for anti-Muellerian hormone, playing a pivotal role in mediating the cellular responses triggered by this hormone.

Measured by its binding ability in a functional ELISA. Immobilized Human rhMIS at 3 μg/mL (100μL/well) can bind Biotinylated Mouse AMHR2. The ED₅₀ for this effect is 240.7 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human rhMIS at 3 μg/mL (100μL/well) can bind Biotinylated Mouse AMHR2 .The ED₅₀ for this effect is 240.7 ng/mL.

Mouse

HEK293

C-His

Q8K592 (Q16-M147)

110542  [NCBI]

Extracellular Domain

QVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCCFGIWNLTHGRAQVEMQGCRDSDEPGCESLHCDPVPRAHPNPSSTLFTCSCGTDFCNANYSHLPPSGNQGAPGPQEPQATPGGPVWM

approximately 25 kDa & 30 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.