1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. APOA1BP Protein, Human (HEK293, His)

APOA1BP protein plays a crucial role in cellular processes by catalyzing the S- and R-type epimerization of NAD(P)HX, a protein that results from enzymatic or heat-dependent hydration. Damaged form of NAD(P)H. This catalytic activity is a prerequisite for the subsequent action of S-specific NAD(P)H hydrate dehydratase, enabling the repair of both epimers of NAD(P)HX. APOA1BP Protein, Human (HEK293, His) is the recombinant human-derived APOA1BP protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

APOA1BP protein plays a crucial role in cellular processes by catalyzing the S- and R-type epimerization of NAD(P)HX, a protein that results from enzymatic or heat-dependent hydration. Damaged form of NAD(P)H. This catalytic activity is a prerequisite for the subsequent action of S-specific NAD(P)H hydrate dehydratase, enabling the repair of both epimers of NAD(P)HX. APOA1BP Protein, Human (HEK293, His) is the recombinant human-derived APOA1BP protein, expressed by HEK293 , with C-His labeled tag.

Background

APOA1BP, also known as NAXE (NAD(P)HX epimerase), catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H resulting from enzymatic or heat-dependent hydration. This epimerization process is a prerequisite for the subsequent repair by the S-specific NAD(P)H-hydrate dehydratase, allowing the restoration of both epimers of NAD(P)HX. Beyond its role in nucleotide metabolism, APOA1BP plays a role in cholesterol homeostasis by accelerating cholesterol efflux from endothelial cells to high-density lipoprotein (HDL). This function suggests a regulatory role for APOA1BP in angiogenesis, linking its enzymatic activity to processes involved in blood vessel formation. It has to underscore APOA1BP's dual functions in nucleotide metabolism and cholesterol homeostasis, emphasizing its potential impact on cellular processes associated with angiogenesis.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q8NCW5-1 (M1-Q288)

Gene ID
Molecular Construction
N-term
APOA1BP (M1-Q288)
Accession # Q8NCW5-1
His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
NAD(P)H-hydrate epimerase; Apolipoprotein A-I-binding protein; AI-BP; YJEFN1; NAXE; AIBP
AA Sequence

MSRLRALLGLGLLVAGSRVPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ

Molecular Weight

Approximately 30.6 kDa.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

APOA1BP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

APOA1BP Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APOA1BP Protein, Human (HEK293, His)
Cat. No.:
HY-P76155
Quantity:
MCE Japan Authorized Agent: