Copy Link Print Information

APOA1BP Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

APOA1BP protein plays a crucial role in cellular processes by catalyzing the S- and R-type epimerization of NAD(P)HX, a protein that results from enzymatic or heat-dependent hydration. Damaged form of NAD(P)H. This catalytic activity is a prerequisite for the subsequent action of S-specific NAD(P)H hydrate dehydratase, enabling the repair of both epimers of NAD(P)HX. APOA1BP Protein, Human (HEK293, His) is the recombinant human-derived APOA1BP protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • APOA1BP Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

APOA1BP protein plays a crucial role in cellular processes by catalyzing the S- and R-type epimerization of NAD(P)HX, a protein that results from enzymatic or heat-dependent hydration. Damaged form of NAD(P)H. This catalytic activity is a prerequisite for the subsequent action of S-specific NAD(P)H hydrate dehydratase, enabling the repair of both epimers of NAD(P)HX. APOA1BP Protein, Human (HEK293, His) is the recombinant human-derived APOA1BP protein, expressed by HEK293 , with C-His labeled tag.

Background

APOA1BP, also known as NAXE (NAD(P)HX epimerase), catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H resulting from enzymatic or heat-dependent hydration. This epimerization process is a prerequisite for the subsequent repair by the S-specific NAD(P)H-hydrate dehydratase, allowing the restoration of both epimers of NAD(P)HX. Beyond its role in nucleotide metabolism, APOA1BP plays a role in cholesterol homeostasis by accelerating cholesterol efflux from endothelial cells to high-density lipoprotein (HDL). This function suggests a regulatory role for APOA1BP in angiogenesis, linking its enzymatic activity to processes involved in blood vessel formation. It has to underscore APOA1BP's dual functions in nucleotide metabolism and cholesterol homeostasis, emphasizing its potential impact on cellular processes associated with angiogenesis.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q8NCW5-1 (M1-Q288)

  • Gene ID
    128240  [NCBI]
  • Molecular Construction
    • N-term
    • APOA1BP (M1-Q288)
      Accession # Q8NCW5-1
    • His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    NAXE; YjeF N-Terminal Domain-Containing Protein 1; Prev. APOA1BP; MGC119145; AIBP; MGC119144; NAD(P)H-Hydrate Epimerase; MGC119143; YJEFN1; YjeF_N1; Apolipoprotein A-I-Binding Protein; Apolipoprotein A-I Binding Protein; AI-BP; PEBEL; NAD(P)HX Epimerase;

  • AA Sequence

    MSRLRALLGLGLLVAGSRVPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ

  • Predicted Molecular Mass

    30.6 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • APOA1BP Protein, Human (HEK293, His) Product Image
    1/16
  • APOA1BP Protein, Human (HEK293, His) Product Image