Apolipoprotein E/APOE2 Protein, Human (C130R, HEK293)
Apolipoprotein E (APOE) plays a key role in lipoprotein-mediated lipid transport and is a core component in the production, transformation, and clearance of plasma lipoproteins. As an amphipathic molecule, APOE binds to various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, favoring HDL. Apolipoprotein E/APOE2 Protein, Human (C130R, HEK293) is the recombinant human-derived Apolipoprotein E/APOE2 protein, expressed by HEK293, with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Apolipoprotein E (APOE) plays a key role in lipoprotein-mediated lipid transport and is a core component in the production, transformation, and clearance of plasma lipoproteins. As an amphipathic molecule, APOE binds to various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, favoring HDL. Apolipoprotein E/APOE2 Protein, Human (C130R, HEK293) is the recombinant human-derived Apolipoprotein E/APOE2 protein, expressed by HEK293, with tag free.
Background
Apolipoprotein E (APOE) is a crucial player in lipoprotein-mediated lipid transport, serving as a core component of plasma lipoproteins involved in their production, conversion, and clearance. Functioning as an amphipathic molecule, APOE associates with various lipoprotein particles, including chylomicrons, chylomicron remnants, very low-density lipoproteins (VLDL), and intermediate density lipoproteins (IDL), with a preference for high-density lipoproteins (HDL). It engages with a range of cellular receptors, such as the LDL receptor (LDLR), LDL receptor-related proteins (LRP1, LRP2, and LRP8), and the very low-density lipoprotein receptor (VLDLR), facilitating cellular uptake of APOE-containing lipoprotein particles. Additionally, APOE exhibits heparin-binding activity, interacting with heparan-sulfate proteoglycans on cell surfaces, supporting the capture and receptor-mediated uptake of APOE-containing lipoproteins. APOE's main function involves mediating lipoprotein clearance through hepatocyte uptake and participating in the biosynthesis and uptake of VLDLs by peripheral tissues for triglyceride delivery and energy storage. It crucially contributes to lipid homeostasis, participating in reverse cholesterol transport and playing roles in the central nervous system, immune responses, and transcriptional regulation, notably in interactions with HCV during microbial infection.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P02649 (K19-H317, C130R)
-
Gene ID348
-
Molecular Construction
-
N-term
-
APOE3 (K19-H317, C130R)
Accession # P02649 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APOE; Apolipoprotein E3; Prev. AD2; APO-E; Alzheimer Disease 2 (APOE*E4-Associated, Late Onset); ApoE4; Apolipoprotein E Isoform 4; Apo-E; Apolipoprotein E Isoform 5; LPG; Apolipoprotein E Isoform 2; Apolipoprotein E; LDLCQ5
-
AA Sequence
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
-
Predicted Molecular Mass
34.4 kDa
-
Molecular Weight
Approximately 34-41 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)