Arginase-1/ARG1 Protein, Human (C-His)
Based on 1 Customer Validation
Arginase-1 Protein, Human (C-His) expresses in E. coli with a His tag at the C-terminus. Arginase-1 Protein inhibits the growth of the arginine-depleting enzyme arginine deiminase (ADI)-resistant Hep3B tumor cells in mice.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Arginase-1 Protein, Human (C-His) expresses in E. coli with a His tag at the C-terminus. Arginase-1 Protein inhibits the growth of the arginine-depleting enzyme arginine deiminase (ADI)-resistant Hep3B tumor cells in mice[1].
Background
Recombinant Human Arginase-1 has IC50s of 0.18 U/ml and 0.07 U/ml for HepG2 and Hep3B cells. Recombinant Human Arginase-1 has a Km value of 1.9 mM for arginine[1].
Verified Bioactivity
Measured by the production of urea during the hydrolysis of arginine. The specific activity is >35,000 pmol/min/μg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P05089 (M1-K322)
-
Molecular Construction
-
N-term
-
ARGI1 (M1-K322)
Accession # P05089 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
ARG1; Type I Arginase; Arginase 1; Arginase, Liver; Arginase-1; Arginase; Liver-Type Arginase
-
AA Sequence
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
-
Predicted Molecular Mass
35.8 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, 20% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Sam-Mui Tsui, et al. Pegylated Derivatives of Recombinant Human Arginase (rhArg1) for Sustained in Vivo Activity in Cancer Therapy: Preparation, Characterization and Analysis of Their Pharmacodynamics in Vivo and in Vitro and Action Upon Hepatocellular Carcinoma Cell (HCC). Cancer Cell Int. 2009 Apr 17;9:9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
