ARHGEF7 Protein, Human (His, Strep)
ARHGEF7 Protein, Human (His, Strep) is the recombinant human-derived ARHGEF7, expressed by E. coli, with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ARHGEF7 Protein, Human (His, Strep) is the recombinant human-derived ARHGEF7, expressed by E. coli, with Strep, His labeled tag.
Background
ARHGEF7 acts as a RAC1 guanine nucleotide exchange factor (GEF) and induces membrane ruffling. It functions in cell migration, attachment, and spreading, promoting RAC1 targeting to focal adhesions (by similar). Additionally, ARHGEF7 may serve as a positive regulator of apoptosis. Downstream of NMDA receptors and the CaMKK-CaMK1 signaling cascade, it facilitates spine and synapse formation in hippocampal neurons.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q14155-4 (K260-R467)
-
Gene ID8874
-
Protein Length
Partial
-
Synonyms
ARHGEF7; PAK3; Rho Guanine Nucleotide Exchange Factor 7; P50; P85SPR; Rho Guanine Nucleotide Exchange Factor (GEF) 7; COOL1; SH3 Domain-Containing Proline-Rich Protein; PIXB; DKFZp686C12170; P85; DKFZp761K1021; PAK-Interacting Exchange Factor Beta; COOL-1
-
AA Sequence
KGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIR
-
Predicted Molecular Mass
27 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
