ART4/CD297 Protein, Mouse (HEK293, His)

ART4/CD297 Protein , a protein that contains a mono-ADP-ribosylation (ART) motif, is involved in peptidyl-arginine ADP-ribosylation. It is a member of the ADP-ribosyltransferase gene family. ART4 is expressed in several structures, including cardiovascular system, genitourinary system, integumental system, liver; and sensory organ. In addition, ART4 plays an important role in erythrocyte invasion by P. falciparum. ART4/CD297 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.

Ecto-ADP-ribosyltransferase 4 (ART4), a protein that contains a mono-ADP-ribosylation (ART) motif, is involved in peptidyl-arginine ADP-ribosylation. It is a member of the ADP-ribosyltransferase gene family. ART4 is expressed in several structures, including cardiovascular system, genitourinary system, integumental system, liver; and sensory organ. The prediction of NAD+ ADP-ribosyltransferase activity emphasizes its potential involvement in post-translational modification processes, particularly in the context of peptidyl-arginine ADP-ribosylation, contributing to the functional diversity of this enzyme. In addition, ART4 plays an important role in erythrocyte invasion by P. falciparum^[1].

Mouse

HEK293

C-6*His

Q9CRA0 (G24-K263)

109978  [NCBI]

Full Length of ART4

GSTEAPLKVDVDLTPDSFDDQYQGCSEQMVEELNQGDYFIKEVDTHKYYSRAWQKAHLTWLNQAKALPESMTPVHAVAIVVFTLNLNVSSDLAKAMARAAGSPGQYSQSFHFKYLHYYLTSAIQLLRKDSSTKNGSLCYKVYHGMKDVSIGANVGSTIRFGQFLSASLLKEETRVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKSGSPKGDLINLRSAGNMSTYNCQLLK

Approximately 38-45 kDa due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Olivieri A, et al. Structural organization of erythrocyte membrane microdomains and their relation with malaria susceptibility. Commun Biol. 2021 Dec 8;4(1):1375.  [Content Brief]