Copy Link Print Information

ASGR2/ASGPR2 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

ASGR2 mediates endocytosis of desialylated glycoproteins, recognizing galactose and N-acetylgalactosamine units. Ligand binding leads to internalization and sorting organelle transport, followed by receptor return to the cell membrane. The receptor is suggested to function as a dimer. ASGR2 also interacts with LASS2. ASGR2/ASGPR2 Protein, Human (HEK293, His) is the recombinant human-derived ASGR2 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • ASGR2/ASGPR2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ASGR2 mediates endocytosis of desialylated glycoproteins, recognizing galactose and N-acetylgalactosamine units. Ligand binding leads to internalization and sorting organelle transport, followed by receptor return to the cell membrane. The receptor is suggested to function as a dimer. ASGR2 also interacts with LASS2. ASGR2/ASGPR2 Protein, Human (HEK293, His) is the recombinant human-derived ASGR2 protein, expressed by HEK293 , with N-His labeled tag.

Background

The ASGR2 protein serves as a mediator in the endocytosis of plasma glycoproteins, particularly those from which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. This receptor exhibits recognition capabilities for terminal galactose and N-acetylgalactosamine units. Upon ligand binding to the receptor, the resulting complex undergoes internalization and is transported to a sorting organelle, where receptor and ligand disassociate. Subsequently, the receptor returns to the cell membrane surface. It is suggested that the functioning ligand-binding unit of this receptor is at least a dimer. Additionally, ASGR2 engages in interactions with LASS2.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-His
  • Accession

    P07307 (Q80-A311)

  • Gene ID
    433  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • ASGR2 (Q80-A311)
      Accession # P07307
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ASGR2; HBXBP; Asialoglycoprotein Receptor 2; HL-2; CLEC4H2; ASGP-R 2; C-Type Lectin Domain Family 4 Member H2; ASGP-R2; HBxAg-Binding Protein; ASGPR 2; Hepatic Lectin H2; ASGPR2

  • AA Sequence

    QSEGHGGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKRRNATGEVA

  • Predicted Molecular Mass

    28.9 kDa

  • Molecular Weight

    Approximately 37-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ASGR2/ASGPR2 Protein, Human (HEK293, His) Product Image
    1/16
  • ASGR2/ASGPR2 Protein, Human (HEK293, His) Product Image