1. Recombinant Proteins
  2. Receptor Proteins
  3. ASGR2/ASGPR2 Protein, Human (HEK293, His)

ASGR2 mediates endocytosis of desialylated glycoproteins, recognizing galactose and N-acetylgalactosamine units. Ligand binding leads to internalization and sorting organelle transport, followed by receptor return to the cell membrane. The receptor is suggested to function as a dimer. ASGR2 also interacts with LASS2. ASGR2/ASGPR2 Protein, Human (HEK293, His) is the recombinant human-derived ASGR2 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE ASGR2/ASGPR2 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ASGR2 mediates endocytosis of desialylated glycoproteins, recognizing galactose and N-acetylgalactosamine units. Ligand binding leads to internalization and sorting organelle transport, followed by receptor return to the cell membrane. The receptor is suggested to function as a dimer. ASGR2 also interacts with LASS2. ASGR2/ASGPR2 Protein, Human (HEK293, His) is the recombinant human-derived ASGR2 protein, expressed by HEK293 , with N-His labeled tag.

Background

The ASGR2 protein serves as a mediator in the endocytosis of plasma glycoproteins, particularly those from which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. This receptor exhibits recognition capabilities for terminal galactose and N-acetylgalactosamine units. Upon ligand binding to the receptor, the resulting complex undergoes internalization and is transported to a sorting organelle, where receptor and ligand disassociate. Subsequently, the receptor returns to the cell membrane surface. It is suggested that the functioning ligand-binding unit of this receptor is at least a dimer. Additionally, ASGR2 engages in interactions with LASS2.

Species

Human

Source

HEK293

Tag

N-His

Accession

P07307 (Q80-A311)

Gene ID

433  [NCBI]

Molecular Construction
N-term
His
ASGR2 (Q80-A311)
Accession # P07307
C-term
Protein Length

Extracellular Domain

Synonyms
Asgr2; Asgr-2; Asialoglycoprotein receptor 2; ASGP-R 2; ASGPR 2; Hepatic lectin 2; HL-2; mHL-2
AA Sequence

QSEGHGGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKRRNATGEVA

Molecular Weight

37-42 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ASGR2/ASGPR2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ASGR2/ASGPR2 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ASGR2/ASGPR2 Protein, Human (HEK293, His)
Cat. No.:
HY-P76736
Quantity:
MCE Japan Authorized Agent: