ASGR2/ASGPR2 Protein, Mouse (His-SUMO)
ASGR2/ASGPR2 proteins are critical in cellular processes, mediating the endocytosis of desialylated plasma glycoproteins. It recognizes terminal galactose and N-acetylgalactosamine, promotes ligand internalization, and forms complexes that are transported to sorting organelles. ASGR2/ASGPR2 Protein, Mouse (His-SUMO) is the recombinant mouse-derived ASGR2/ASGPR2 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ASGR2/ASGPR2 proteins are critical in cellular processes, mediating the endocytosis of desialylated plasma glycoproteins. It recognizes terminal galactose and N-acetylgalactosamine, promotes ligand internalization, and forms complexes that are transported to sorting organelles. ASGR2/ASGPR2 Protein, Mouse (His-SUMO) is the recombinant mouse-derived ASGR2/ASGPR2 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.
ASGR2/ASGPR2 Protein plays a crucial role in cellular processes by mediating the endocytosis of plasma glycoproteins from which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. Recognizing terminal galactose and N-acetylgalactosamine units, the receptor facilitates the internalization of ligands, forming a complex that is subsequently transported to a sorting organelle. Within this organelle, the receptor and ligand dissociate, and the receptor is then recycled back to the cell membrane surface. ASGR2/ASGPR2's engagement in these dynamic processes highlights its significance in the cellular handling of glycoproteins and contributes to the regulation of cellular homeostasis. The protein also interacts with LASS2, further expanding its molecular associations and potential implications in cellular signaling or coordination.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His;N-SUMO
-
Accession
P24721 (Q80-H301)
-
Molecular Construction
-
N-term
-
10*His-SUMO
-
ASGR2 (Q80-H301)
Accession # P24721 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ASGR2; HBXBP; Asialoglycoprotein Receptor 2; HL-2; CLEC4H2; ASGP-R 2; C-Type Lectin Domain Family 4 Member H2; ASGP-R2; HBxAg-Binding Protein; ASGPR 2; Hepatic Lectin H2; ASGPR2
-
AA Sequence
QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH
-
Predicted Molecular Mass
45.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
