ATP1B1 Protein, Mouse (Cell-Free, His)
Based on 1 Customer Validation
The ATP1B1 protein is a noncatalytic component that forms a heterodimer with the α subunit and catalyzes ATP hydrolysis and Na(+) and K(+) ion exchange across the plasma membrane. These heterodimers critically regulate sodium pumping at the plasma membrane, affecting ion balance. ATP1B1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived ATP1B1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ATP1B1 protein is a noncatalytic component that forms a heterodimer with the α subunit and catalyzes ATP hydrolysis and Na(+) and K(+) ion exchange across the plasma membrane. These heterodimers critically regulate sodium pumping at the plasma membrane, affecting ion balance. ATP1B1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived ATP1B1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Background
ATP1B1 Protein serves as the non-catalytic component of the active enzyme responsible for catalyzing the hydrolysis of ATP, coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. As a crucial subunit, ATP1B1, in conjunction with the alpha subunit, forms heterodimers that regulate the quantity of sodium pumps transported to the plasma membrane. Beyond its role in ion transport, ATP1B1 is implicated in essential cellular processes, including cell adhesion and the establishment of epithelial cell polarity. This multifaceted functionality underscores the significance of ATP1B1 in cellular homeostasis, ion balance, and the maintenance of structural integrity within tissues.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P14094 (M1-S304)
-
Gene ID11931
-
Molecular Construction
-
N-term
-
10*His
-
ATP1B1 (M1-S304)
Accession # P14094 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ATP1B1; Sodium/Potassium-Transporting ATPase Beta-1 Chain; Prev. ATP1B; Sodium/Potassium-Dependent ATPase Beta-1 Subunit; Sodium/Potassium-Transporting ATPase Subunit Beta-1; Beta 1-Subunit Of Na(+),K(+)-ATPase; Sodium-Potassium ATPase Subunit Beta 1 (Non
-
AA Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS
-
Predicted Molecular Mass
36.7 kDa
-
Molecular Weight
Approximately 35 kDa (Monomer) & 70 kDa (Dimer), based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij-78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
