ATP1B1 Protein, Mouse (Cell-Free, His)

The ATP1B1 protein is a noncatalytic component that forms a heterodimer with the α subunit and catalyzes ATP hydrolysis and Na(+) and K(+) ion exchange across the plasma membrane. These heterodimers critically regulate sodium pumping at the plasma membrane, affecting ion balance. ATP1B1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived ATP1B1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ATP1B1 Protein, Mouse (Cell-Free, His) is 304 a.a., with predicted molecular weight of 36.7 kDa.

ATP1B1 Protein serves as the non-catalytic component of the active enzyme responsible for catalyzing the hydrolysis of ATP, coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. As a crucial subunit, ATP1B1, in conjunction with the alpha subunit, forms heterodimers that regulate the quantity of sodium pumps transported to the plasma membrane. Beyond its role in ion transport, ATP1B1 is implicated in essential cellular processes, including cell adhesion and the establishment of epithelial cell polarity. This multifaceted functionality underscores the significance of ATP1B1 in cellular homeostasis, ion balance, and the maintenance of structural integrity within tissues.

Mouse

E. coli Cell-free

N-10*His

P14094 (M1-S304)

11931

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS

Monomer: 35 kDa Dimer: 70 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.