ATP6 Protein, Human (His)

ATP6 Protein, Human (His) is the recombinant human-derived ATP6 protein, expressed by E. coli, with N-10*His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ATP6 Protein, Human (His) is the recombinant human-derived ATP6 protein, expressed by E. coli, with N-10*His tag.

Background

ATP6 is subunit a of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V), which synthesizes ATP from ADP in the presence of a proton gradient across the membrane generated by the electron transport complexes of the respiratory chain (Probable). The ATP synthase complex consists of a soluble F(1) head domain (the catalytic core) and a membrane-bound F(0) domain (the proton channel) (by similar: PubMed:37244256). These two domains are connected by a central stalk rotating within the F(1) region and a stationary peripheral stalk (by similar: PubMed:37244256). During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits (Probable). Together with subunit c (ATP5MC1), ATP6 forms the proton-conducting channel in the F(0) domain, which contains two critical half-channels (inlet and outlet) that facilitate proton movement from the mitochondrial intermembrane space (IMS) into the matrix (by similar: PubMed:37244256). Protons are taken up via the inlet half-channel and released through the outlet half-channel, following a Grotthuss mechanism (by similar: PubMed:37244256).

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • ATP6 (M1-T226)
      Accession # P00846
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    MT-ATP6; Proton-Conducting Channel, ATP Synthase F(0) Complex Subunit A; Prev. MTATP6; Mitochondrially Encoded ATP Synthase 6; Prev. RP; ATP Synthase F(0) Complex Subunit A; ATP6; ATP Synthase F0 Subunit 6; ATPase-6; ATP Synthase Subunit A; ATPase6; F-ATP

  • AA Sequence

    MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT

  • Predicted Molecular Mass

    26.3 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00