ATP6 Protein, Human (His)
ATP6 Protein, Human (His) is the recombinant human-derived ATP6 protein, expressed by E. coli, with N-10*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ATP6 Protein, Human (His) is the recombinant human-derived ATP6 protein, expressed by E. coli, with N-10*His tag.
Background
ATP6 is subunit a of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V), which synthesizes ATP from ADP in the presence of a proton gradient across the membrane generated by the electron transport complexes of the respiratory chain (Probable). The ATP synthase complex consists of a soluble F(1) head domain (the catalytic core) and a membrane-bound F(0) domain (the proton channel) (by similar: PubMed:37244256). These two domains are connected by a central stalk rotating within the F(1) region and a stationary peripheral stalk (by similar: PubMed:37244256). During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits (Probable). Together with subunit c (ATP5MC1), ATP6 forms the proton-conducting channel in the F(0) domain, which contains two critical half-channels (inlet and outlet) that facilitate proton movement from the mitochondrial intermembrane space (IMS) into the matrix (by similar: PubMed:37244256). Protons are taken up via the inlet half-channel and released through the outlet half-channel, following a Grotthuss mechanism (by similar: PubMed:37244256).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His
-
Accession
P00846 (M1-T226)
-
Gene ID4580
-
Molecular Construction
-
N-term
-
10*His
-
ATP6 (M1-T226)
Accession # P00846 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MT-ATP6; Proton-Conducting Channel, ATP Synthase F(0) Complex Subunit A; Prev. MTATP6; Mitochondrially Encoded ATP Synthase 6; Prev. RP; ATP Synthase F(0) Complex Subunit A; ATP6; ATP Synthase F0 Subunit 6; ATPase-6; ATP Synthase Subunit A; ATPase6; F-ATP
-
AA Sequence
MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT
-
Predicted Molecular Mass
26.3 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)