1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Other Kinases
  4. Aur
  5. AURKC/AurC
  6. AURC Protein, Human (sf9, GST)

AURC is a key serine/threonine protein kinase that plays a critical regulatory role in mitosis as part of the chromosomal passenger complex (CPC), ensuring accurate chromosome alignment and segregation. It contributes to chromatin-induced microtubule stabilization and spindle assembly. AURC Protein, Human (sf9, GST) is the recombinant human-derived AURC protein, expressed by sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AURC is a key serine/threonine protein kinase that plays a critical regulatory role in mitosis as part of the chromosomal passenger complex (CPC), ensuring accurate chromosome alignment and segregation. It contributes to chromatin-induced microtubule stabilization and spindle assembly. AURC Protein, Human (sf9, GST) is the recombinant human-derived AURC protein, expressed by sf9 insect cells , with N-GST labeled tag.

Background

AURC, a serine/threonine-protein kinase, functions as a pivotal component of the chromosomal passenger complex (CPC), a critical regulator of mitosis. The CPC complex is indispensable at the centromere for ensuring accurate chromosome alignment and segregation, crucial for chromatin-induced microtubule stabilization and spindle assembly. In addition to its role in mitosis, AURC plays a role in meiosis, particularly in spermatogenesis. It shares redundant cellular functions with AURKB and can rescue an AURKB knockdown. Similar to AURKB, AURKC phosphorylates histone H3 at 'Ser-10' and 'Ser-28'. AURKC also phosphorylates CPC complex subunits BIRC5/survivin and INCENP, enhancing AURKC activity. Furthermore, AURC targets TACC1, a protein involved in cell division, by phosphorylating it at 'Ser-228'.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

Q9UQB9 (S2-S309)

Gene ID

6795

Molecular Construction
N-term
GST
AURC (S2-S309)
Accession # Q9UQB9
C-term
Protein Length

Partial

Synonyms
AURKC; Aurora kinase C; Aurora 3; Aurora/IPL1-related kinase 3; ARK-3; Aurora-related kinase 3; Aurora/IPL1/Eg2 protein 2; Serine/threonine-protein kinase 13; Serine/threonine-protein kinase aurora-C
AA Sequence

SSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AURC Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AURC Protein, Human (sf9, GST)
Cat. No.:
HY-P701710
Quantity:
MCE Japan Authorized Agent: