AURC Protein, Human (sf9, GST)
AURC is a key serine/threonine protein kinase that plays a critical regulatory role in mitosis as part of the chromosomal passenger complex (CPC), ensuring accurate chromosome alignment and segregation. It contributes to chromatin-induced microtubule stabilization and spindle assembly. AURC Protein, Human (sf9, GST) is the recombinant human-derived AURC protein, expressed by sf9 insect cells , with N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AURC is a key serine/threonine protein kinase that plays a critical regulatory role in mitosis as part of the chromosomal passenger complex (CPC), ensuring accurate chromosome alignment and segregation. It contributes to chromatin-induced microtubule stabilization and spindle assembly. AURC Protein, Human (sf9, GST) is the recombinant human-derived AURC protein, expressed by sf9 insect cells , with N-GST labeled tag.
Background
AURC, a serine/threonine-protein kinase, functions as a pivotal component of the chromosomal passenger complex (CPC), a critical regulator of mitosis. The CPC complex is indispensable at the centromere for ensuring accurate chromosome alignment and segregation, crucial for chromatin-induced microtubule stabilization and spindle assembly. In addition to its role in mitosis, AURC plays a role in meiosis, particularly in spermatogenesis. It shares redundant cellular functions with AURKB and can rescue an AURKB knockdown. Similar to AURKB, AURKC phosphorylates histone H3 at 'Ser-10' and 'Ser-28'. AURKC also phosphorylates CPC complex subunits BIRC5/survivin and INCENP, enhancing AURKC activity. Furthermore, AURC targets TACC1, a protein involved in cell division, by phosphorylating it at 'Ser-228'.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
Q9UQB9-1 (S2-S309)
-
Gene ID6795
-
Molecular Construction
-
N-term
-
GST
-
AURC (S2-S309)
Accession # Q9UQB9-1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
AURKC; ARK-3; Prev. STK13; AIK3; ARK3; Non-Specific Serine/Threonine Protein Kinase; AurC; Epididymis Secretory Protein Li 90; Serine/Threonine Kinase 13 (Aurora/IPL1-Like); Aurora/IPL1/EG2 Protein 2; Serine/Threonine-Protein Kinase Aurora-C; Aurora/IPL1/Eg2 Protein 2; Serine/Threonine-Protein Kinase 13; HEL-S-90; Aurora/IPL1-Related Kinase 3; Aurora-C; Aurora-Related Kinase 3; SPGF5; Aurora 3; AIRK3; Aurora Kinase C; AIE2
-
AA Sequence
SSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
