B4GALT4 Protein, Human (HEK293, His)
B4GALT4 Protein, Human (HEK293, His) encodes a type II membrane protein with significant sequence similarity to other β1,4-galactosyltransferases. B4GALT4 mainly plays a role in glycolipid biosynthesis and has been recognized involving in cancer metastatic processes[1][2].
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
B4GALT4 Protein, Human (HEK293, His) encodes a type II membrane protein with significant sequence similarity to other β1,4-galactosyltransferases. B4GALT4 mainly plays a role in glycolipid biosynthesis and has been recognized involving in cancer metastatic processes[1][2].
Background
Highly expression of B4GALT4 is linked to colorectal cancer metastasis and poor prognosis. B4Gal-T4 is an active UDPGal: βGlcNAcβ1,4Gal-transferase with specificity for glycolipid substrates; however, it does not catalyze glycosylation of several glycoprotein acceptors, which are good substrates for other β4Gal-transferases[1][2].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O60513 (Q39-A344)
-
Molecular Construction
-
N-term
-
B4GALT4 (Q39-A344)
Accession # O60513 -
6*His
-
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
B4GALT4; Beta-1,4-GalTase 4; Beta-1,4-Galactosyltransferase 4; Nal Synthase; Beta4Gal-T4; B4Gal-T4; UDP-Galactose:Beta-N-Acetylglucosamine Beta-1,4-Galactosyltransferase 4; Beta-N-Acetylglucosaminyl-Glycolipid Beta-1,4-Galactosyltransferase 4; UDP-Gal:Bet
-
AA Sequence
QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
-
Predicted Molecular Mass
36.8 kDa
-
Molecular Weight
Approximately 34-43 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. H Zhou, et al. B4GALT family mediates the multidrug resistance of human leukemia cells by regulating the hedgehog pathway and the expression of p-glycoprotein and multidrug resistance-associated protein 1. ell Death Dis. 2013 Jun 6;4(6):e654. [Content Brief]
[2]. T Schwientek, et al. Cloning of a novel member of the UDP-galactose:beta-N-acetylglucosamine beta1,4-galactosyltransferase family, beta4Gal-T4, involved in glycosphingolipid biosynthesis. J Biol Chem. 1998 Nov 6;273(45):29331-40. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
