Copy Link Print Information

B7-H6 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

B7-H6, a distinctive monomeric protein, uniquely triggers NCR3-dependent natural killer (NK) cell activation, specifically interacting with NCR3 while avoiding engagement with other NK cell-activating receptors (NCR1, NCR2, and KLRK1). This specificity underscores B7-H6's unique role in initiating NK cell responses through the NCR3 pathway within the intricate network of NK cell activation mechanisms. B7-H6 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H6 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • B7-H6 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

B7-H6, a distinctive monomeric protein, uniquely triggers NCR3-dependent natural killer (NK) cell activation, specifically interacting with NCR3 while avoiding engagement with other NK cell-activating receptors (NCR1, NCR2, and KLRK1). This specificity underscores B7-H6's unique role in initiating NK cell responses through the NCR3 pathway within the intricate network of NK cell activation mechanisms. B7-H6 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H6 protein, expressed by HEK293 , with C-His labeled tag.

Background

B7-H6, a distinctive protein, serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors, such as NCR1, NCR2, and KLRK1. This interaction highlights its unique role in initiating NK cell responses through the NCR3 pathway, showcasing its specificity in the intricate network of NK cell activation mechanisms.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized rat NCR3 at 10 μg/mL can bind rat B7-H6. The ED50 for this effect is 14.43 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession

    XP_006223356 (M1-S308)

  • Gene ID
    691092  [NCBI]
  • Molecular Construction
    • N-term
    • B7-H6 (M1-S308)
      Accession # XP_006223356
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NCR3LG1; B7 Homolog 6; Natural Killer Cell Cytotoxicity Receptor 3 Ligand 1; Natural Cytotoxicity Triggering Receptor 3 Ligand 1; B7-H6; B7H6; DKFZp686O24166; Putative Ig-Like Domain-Containing Protein DKFZp686O24166/DKFZp686I21167

  • AA Sequence

    MASQSCQRGPENAHMHPKGPCCSALCFLCSLGSSPHGSSLGPLRKCGRRSKPVQSSPEGSRVAEWPDGLLSLLLLLWSLLPSAGGLELEMAGTTQIVFLHEDVTIPCKILGSLHLDLSIVGVIWSLKKDGDESEVFKFYGDQLEAVRPGANVSLLGLEHGDASLYLPRFELWEAGEYQCKVVVTPEKKEGTTRLEVVAHPNMSLSEKPATARGGKEKLIICQLDGFYPEALDIKWMGSALKDSHFQEITEGVVTGPTVKNDDGTFSVTSSLALKPALEDHMYQCVVWHRSWLMPQSLNVTVFENKPRS

  • Molecular Weight

    Approximately 35-46 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • B7-H6 Protein, Rat (HEK293, His) Product Image
    1/16
  • B7-H6 Protein, Rat (HEK293, His) Product Image