BAD Protein, Human (His, Myc)
BAD Protein, Human (His, Myc) is the recombinant human-derived BAD, expressed by E.coli, with His, Myc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BAD Protein, Human (His, Myc) is the recombinant human-derived BAD, expressed by E.coli, with His, Myc labeled tag.
Background
Bad is a protein that promotes cell death. It successfully competes for binding to Bcl-X(L), Bcl-2, and Bcl-W, thereby influencing the heterodimerization levels of these proteins with BAX. Bad can reverse the death repressor activity of Bcl-X(L) but not that of Bcl-2 (By similarity). Additionally, it appears to act as a link between growth factor receptor signaling and apoptotic pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
Q92934 (E30-E234)
-
Gene ID572
-
Protein Length
partial
-
Synonyms
BAD; Bcl-2-Like Protein 8; BCL2 Associated Agonist Of Cell Death; Bcl2-L-8; BCL2L8; BCL2-Antagonist Of Cell Death Protein; BBC2; BCL-X/BCL-2 Binding Protein; Bcl-XL/Bcl-2-Associated Death Promoter; BCL2-Binding Component 6; Bcl2-Associated Agonist Of Cell
-
AA Sequence
EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVGRCGHSESELQVFWVDRAYALKMLFVKESHNMSKGPEETWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCAVDEREQLEE
-
Predicted Molecular Mass
30.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
